KEGG   Rattus norvegicus (rat): 300678Help
Entry
300678            CDS       T01003                                 

Gene name
Cd3g
Definition
(RefSeq) CD3g molecule
  KO
K06452  T-cell surface glycoprotein CD3 gamma chain
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04640  Hematopoietic cell lineage
rno04658  Th1 and Th2 cell differentiation
rno04659  Th17 cell differentiation
rno04660  T cell receptor signaling pathway
rno05142  Chagas disease (American trypanosomiasis)
rno05162  Measles
rno05166  Human T-cell leukemia virus 1 infection
rno05169  Epstein-Barr virus infection
rno05170  Human immunodeficiency virus 1 infection
rno05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    300678 (Cd3g)
   04660 T cell receptor signaling pathway
    300678 (Cd3g)
   04658 Th1 and Th2 cell differentiation
    300678 (Cd3g)
   04659 Th17 cell differentiation
    300678 (Cd3g)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    300678 (Cd3g)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    300678 (Cd3g)
   05170 Human immunodeficiency virus 1 infection
    300678 (Cd3g)
   05162 Measles
    300678 (Cd3g)
   05169 Epstein-Barr virus infection
    300678 (Cd3g)
  09174 Infectious disease: parasitic
   05142 Chagas disease (American trypanosomiasis)
    300678 (Cd3g)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:rno04090]
    300678 (Cd3g)
CD molecules [BR:rno04090]
 Proteins
  300678 (Cd3g)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ig_4 Ig_5 ITAM Ig_3
Motif
Other DBs
NCBI-GeneID: 300678
NCBI-ProteinID: NP_001071114
RGD: 1307718
Ensembl: ENSRNOG00000015945
UniProt: Q64159
Position
8q22
AA seq 182 aa AA seqDB search
MEQGKGLAGLFLVISLLQGTMAQQKEEKHLVKVDDSQGDGSVLLTCDFNEKTITWLKDGH
RISPPNATKSTWNLGNGAKDPRGMYQCRGAKKKSQLLQVYYRLCENCIELNMGTVSGFIF
AEIISIFFLAVGVYFIAGQDGVRQSRASDKQTLLQNEQVYQPLKDREYEQYSRLQGNQVR
KK
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atggagcaggggaaaggtttggctggcctcttcctggtgatctctcttcttcaaggcacc
atggcccagcaaaaagaagaaaagcatttggtaaaagtggatgacagccaaggagatggc
tctgtacttctgacttgtgacttcaatgagaagactatcacatggcttaaagatgggcac
agaataagtcctccaaatgcaactaaaagcacgtggaatctgggcaacggtgccaaagac
cctcgaggcatgtatcagtgccgaggagcaaagaagaagtcgcagctcctgcaagtgtac
tacagactgtgtgagaactgcattgagctaaatatgggcactgtgtccggctttatcttc
gctgaaatcatcagcattttcttccttgctgttggtgtatacttcattgctggacaggat
ggagttcgccagtcaagagcttcagacaagcagactctgttgcaaaatgaacaggtctac
cagcccctcaaggaccgggaatatgaacagtacagccgtctccaaggaaaccaagtgaga
aagaagtga

DBGET integrated database retrieval system