KEGG   Rattus norvegicus (rat): 300726
Entry
300726            CDS       T01003                                 
Symbol
Etfa
Name
(RefSeq) electron transfer flavoprotein subunit alpha, mitochondrial
  KO
K03522  electron transfer flavoprotein alpha subunit
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    300726 (Etfa)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   300726 (Etfa)
SSDB
Motif
Pfam: ETF ETF_alpha
Other DBs
NCBI-GeneID: 300726
NCBI-ProteinID: NP_001009668
RGD: 628747
Ensembl: ENSRNOG00000015233
UniProt: P13803
Position
8:complement(55835115..55891890)
AA seq 333 aa
MFRAAAPGQLRRAASLLRFQSTLVIAEHANDSLAPITLNTITAAGRLGGEVSCLVAGTKC
DKVVQDLCKVAGVAKVLVAQHDAYKGLLPEELTPLILETQKQFSYTHICAGASAFGKNLL
PRVAAKLNVAPVSDIIEIKSPDTFVRTIYAGNALCTVKCDEKVKVFSVRGTSFEAAAASG
GSASSEKAPSSSSAGISEWLDQKLTKSDRPELTGAKVVVSGGRGLKSGENFKLLYDLADQ
LHAAVGASRAAVDAGFVPNDMQVGQTGKIVAPELYIAVGISGAIQHLAGMKDSKTIVAIN
KDPEAPIFQVADYGIVADLFKVVPEMTEILKKK
NT seq 1002 nt   +upstreamnt  +downstreamnt
atgtttcgagcagcggcgcctgggcagctccggcgggcggcctcgttgctccgttttcag
agcaccttggtaatagctgagcatgcgaatgattctctagcacccattactctaaacact
atcactgcagctggacgtcttggaggtgaagtgtcctgcttagtagctggaacaaaatgt
gacaaggtggtacaggatctctgtaaagtagcaggcgtggcaaaggttctggtggctcag
catgatgcgtacaaaggccttcttccagaggaactcacaccattgattttggaaactcag
aagcagttcagttacacacacatctgtgctggagcatctgcttttggaaagaaccttctg
cccagagtagcagccaaacttaatgttgccccagtttctgacatcattgagatcaagtca
cctgacacatttgtgagaactatctatgcaggaaatgcattgtgtacagtgaaatgtgat
gagaaagtgaaggtgttttctgttcgaggaacatcttttgaggctgcagcagcaagtgga
ggtagtgccagttcagaaaaggcaccaagttcttcatcagcaggaatatcagagtggctt
gaccagaaattgacaaaaagtgaccgaccagagctaactggtgccaaagtggtggtatct
ggtggtcggggcttgaagagtggagagaactttaaactgctgtatgacttggcagatcag
ctgcatgctgcagttggtgcttcccgtgctgctgttgatgctggctttgttcccaatgac
atgcaagttggtcagacaggaaaaatagtagctccagaactttatattgctgttggaata
tctggagccatccagcatttagctgggatgaaggacagcaagacaattgtggctattaac
aaagacccagaagctccaattttccaagtggcagattatggaatagttgcagatttattt
aaggtggttcctgaaatgacagaaatactgaagaaaaaataa

DBGET integrated database retrieval system