KEGG   Rattus norvegicus (rat): 300732Help
Entry
300732            CDS       T01003                                 

Gene name
Pstpip1
Definition
(RefSeq) proline-serine-threonine phosphatase-interacting protein 1
  KO
K12804  proline-serine-threonine phosphatase interacting protein 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04621  NOD-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    300732 (Pstpip1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    300732 (Pstpip1)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Bin/Amphiphysin/Rvs (BAR) family proteins
   F-BAR proteins
    300732 (Pstpip1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SH3_9 SH3_1 FCH SH3_2 SH3_3 RNA_pol_Rpc82
Motif
Other DBs
NCBI-GeneID: 300732
NCBI-ProteinID: NP_001100294
RGD: 1307557
Ensembl: ENSRNOG00000016413
UniProt: B0BNK4
Position
8q24
AA seq 416 aa AA seqDB search
MTAQLQFRDAFWCRDFTAHTGYEVLLQRLLDGRKMCKDVEELLRQRAQAEERYGKELVQI
ARKAGGQTEMNSLRTSFDSLKQQTENVGSAHIQLALALREELRSLEEFRERQKEQRKKYE
AVMDRVQKSKLSLYKKTMESKKSYDQKCRDADDAEQAFERVSASGHQKQIEKSQTKAKQC
KESATEADRVYRQNIEQLEKARTEWEQEHRTTCEAFQLQEFDRLTILRNALWVHCNQLSM
QCVKDDELYEEVRLTLEGCDVEGDINGFIQSKSTGREPPAPVPYQNYYDREVTPLTGSPI
VQTSCGVIKRFSGLLHGSPKTTPSQAPAASTETLAPTSEQKELVYASIEVQATQGNLNSA
AQDYRALYDYTAQNSDELDISAGDILAVILEGEDGWWTVERNGQRGFVPGSYLEKL
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcccagctgcagttccgcgatgccttctggtgcagggacttcacggcccacaca
gggtatgaggtactcctgcagaggctgctggacggcaggaagatgtgcaaggatgtggag
gagctgctcagacagagggcccaggcggaggagaggtacgggaaggagctggtgcagatt
gcgcgcaaagctggtggccagacagagatgaattccctgaggacctcctttgactctctg
aagcagcaaacagagaatgtgggcagtgcacacatccagctggccctggccctgcgtgag
gagctgcggagcctggaggagttccgagagagacagaaagaacagcggaagaagtatgag
gccgtcatggaccgtgtccagaagagcaagctgtcgctctacaagaagaccatggagtcc
aagaagtcatatgaccagaagtgcagggacgcagatgacgctgagcaggccttcgagcga
gtgagtgccagtggtcaccaaaagcaaatagaaaagagccagaccaaagccaagcagtgc
aaggagtcggccacagaggcagatcgagtgtacaggcaaaatattgaacaactggagaaa
gcaaggaccgaatgggaacaggaacaccggacaacctgtgaggccttccagctgcaggag
tttgaccggctaaccatcctccgcaatgccctgtgggtgcactgtaaccagctctccatg
cagtgtgtcaaggacgatgagctctatgaggaagtccggctgacacttgagggctgtgat
gtggaaggtgatatcaatggcttcatccagtccaagagcactggcagagagcccccagct
cccgtgccttatcagaactactacgaccgggaggtcaccccactgactggcagccctatc
gtccagacctcctgtggtgtgataaagaggttctctgggctgctacatggaagtcccaag
accacaccttctcaagctcctgccgcttccacagagactctggctcccacctctgagcag
aaagaattggtctatgcatccatcgaagtgcaggcaacccaggggaaccttaactcagca
gcccaggactaccgggcgctctatgactacacggcacagaattctgatgagctggacatt
tctgcgggagacatcctggcagtcatcctggaaggggaggatggctggtggactgtggaa
cgaaacggacaacgtggctttgtccctggttcgtacttggagaagctctga

DBGET integrated database retrieval system