KEGG   Rattus norvegicus (rat): 300743Help
Entry
300743            CDS       T01003                                 

Gene name
Lman1l, slamp
Definition
(RefSeq) lectin, mannose-binding, 1 like
  KO
K10081  lectin, mannose-binding 1-like
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    300743 (Lman1l)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04091 Lectins [BR:rno04091]
    300743 (Lman1l)
Lectins [BR:rno04091]
 L-type lectins
  300743 (Lman1l)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lectin_leg-like NAGLU_C
Motif
Other DBs
NCBI-GeneID: 300743
NCBI-ProteinID: NP_001012483
RGD: 1310538
Ensembl: ENSRNOG00000019355
UniProt: Q5FB95
Position
8q24
AA seq 503 aa AA seqDB search
MLKTGGLSPSLCLLSLLLALHSAERSYPPPQRRFEYKLSFKGPRLAVPGAGIPFWSHHGD
AIPGLEEVRLVPSMKNRSGAVWSEISVSFPSWEVEMQMRVTGPGRRGALGVAMWYTKDRD
QVGSVVEGLASWDGIGIYFDSSSNDVQNGPAIRVLASDGHDLQEQFGDGTVRELGSCLRD
FRNRPHPFRARITYWRQRLRVSLSGGLTPNDPEEVCVDVEPLLLAPGGFFGVSAATSTLA
DDHDVLSFLTFSLRDPGSEEALQPFTEKEQFHLARKLEELKARLALGTREDTILPLNSKA
QEEGERFFNLEDTLSRQSQILQALQALSRQMDQAEKQWKQQLGSVVQIRPEGGWNTAKVS
TLLYGQRTLIQALQEMREAAAQMASGAQVFYLPVGTKHHFFELDQTLGLLQKDLRDLVKM
TAKPPRPSGWLPGFSTCLRTSIFLFFLLIQTVGFFCYMNFRQELDKRLQEYLFTESISLQ
PALPIPRTIGVLRRQPVSPSMQA
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgctgaagacaggaggcctctcaccttccctctgcctcctttccctcctgctggctcta
catagtgctgaaaggagttacccccctcctcaacgcaggtttgagtacaagctcagcttc
aagggaccaagactggcagttcctggagctggaattcccttctggagccaccatggagac
gccattccaggcctagaggaagtacggctggttccatctatgaagaaccggagcggtgcc
gtgtggagtgagatctctgtctccttcccttcctgggaagtagagatgcagatgagagtg
acaggaccgggacgccggggagccctgggtgtggccatgtggtacaccaaggacagagat
caagttggctctgttgtggagggactggcctcatgggatggcattgggatctactttgat
tcctcctccaatgatgtccagaacggtcctgccatccgagtgctggccagtgatgggcat
gacctccaggagcagtttggggatggaactgtccgggagcttggctcctgtcttagggac
ttcaggaaccggccacaccccttccgagctcggatcacctactggaggcagaggctgcgt
gtgtccttgagtggaggccttactcctaatgaccctgaagaggtctgtgtcgatgtggag
cccctgcttttagcccctggaggcttttttggggtctcagcagccaccagtaccttagca
gatgaccatgacgtcctgtccttcctgaccttcagtttgagggacccaggttcagaggaa
gccctccagccattcacagagaaggagcagttccacctggccaggaagctggaagaactg
aaggcaaggctggccctgggtaccagagaggataccatactaccactgaactccaaagcc
caggaagaaggggaaaggttctttaacctggaggatacactgagcagacaaagccagatc
ctgcaggccctccaggctctctccaggcagatggatcaggctgagaaacagtggaaacag
cagttggggtctgtggtccaaatccggcctgagggaggctggaacactgccaaggtcagc
accctgctctatggacagcggactctgatccaggctctgcaagagatgagggaagcagct
gcccagatggcttcaggagcacaagtcttctacctgcctgtgggcactaaacatcacttt
tttgagctggaccagaccctcggcctcctgcagaaggacctccgggatctggtgaaaatg
acagccaagcctccccgcccatctggctggctcccaggattctccacatgtctgcggacc
agcatcttcctgttcttcctcctaatccagactgtaggcttcttctgctacatgaacttc
aggcaggagctggacaagaggcttcaggagtacctgttcacagaaagcatttctctacag
cctgcattgcccatccctaggacaataggggttctgaggagacagcctgtctcccccagc
atgcaagcctga

DBGET integrated database retrieval system