KEGG   Rattus norvegicus (rat): 300754
Entry
300754            CDS       T01003                                 

Gene name
Bbs4
Definition
(RefSeq) Bardet-Biedl syndrome 4
  KO
K16531  Bardet-Biedl syndrome 4 protein
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    300754 (Bbs4)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Pericentriolar materials (PCM)
    Centriolar satellite
     300754 (Bbs4)
   BBSome complex
    300754 (Bbs4)
SSDB
Motif
Pfam: TPR_2 TPR_1 TPR_8 TPR_11 TPR_19 TPR_14 TPR_12 TPR_16 TPR_9 TPR_17 ANAPC3 TPR_7 TPR_6 TPR_10 TPR_15 Wzy_C_2 NARP1 PknG_TPR TPR_20 TPR_MalT Coatomer_E DUF3808 Mu-like_Pro
Other DBs
NCBI-GeneID: 300754
NCBI-ProteinID: NP_001100296
RGD: 1309134
Ensembl: ENSRNOG00000026171
UniProt: D4A8B1
Position
8q24
AA seq 520 aa
MAEEKLGMKTQVPASIESQKPRPKKAPEFPIVEKLNWLIHLYYIRKDYEACKAVIKEQLQ
ETQGLCEYAIYVQALIFRLEGNIQESLELFQTCAVLSPQCADNLKQVARSLFLLGKHKAA
TEVYNEAAKLNQKDWEICHNLGVCYTYLKQFSKAQDQLHSALQLNKHDLTYIMLGKIHLL
QGDLDKAIEIYKKAVEFSPENTELLTTLGLLYLQLGVYQKAFEHLGNALTYDPANYKAIL
AAGSMMQTHGDFDVALTKYRVVACAIPESPPLWNNIGMCFFGKKKYVAAISCLKRANYLA
PFDWKILYNLGLVHLTMQQYASAFHFLSAAINFQPKMGELYMLLAVALTNLEDIENAKRA
YVEAVRLDKCNPLVNLNYAVLLYNQGEKKGALAQYQEMEKKVHFLKDNNPLEFDSEMVEM
AQKLGAALQVGEALVWTKPVKDPKSKHRTNSGSKSATLQQPLGSFQALGQAMSSAAAHRK
IPSGAVGAQLTKPPSLPLEPEPEPTVEASPTEASEQNKEK
NT seq 1563 nt   +upstreamnt  +downstreamnt
atggctgaggagaagcttgggatgaaaactcaggttcctgcatctattgaatctcaaaaa
cccaggccaaaaaaagctccagagtttcctattgtggagaagctgaactggctgatccat
ctctactatatccggaaggattatgaggcgtgcaaggctgtgatcaaagaacagcttcag
gagactcaagggctgtgtgaatatgctatttatgtccaagcactgattttccgcctggaa
ggaaatatccaagaatccctagaactctttcagacgtgtgctgttctcagcccacagtgt
gctgataatctcaagcaggtggccagatctttatttcttctgggaaaacataaagccgcc
acagaagtatataatgaagcagctaagctcaaccagaaagactgggagatctgccataac
ctgggagtgtgctacacttacctaaagcagttcagcaaggcgcaagaccaattgcacagt
gccctccagcttaacaagcatgacctgacttacattatgctggggaagatccatttactg
cagggagacttggataaagccattgagatctacaagaaagcagtggagttctctccagaa
aatacagaacttctcacaactttaggattactctacctacagcttggtgtttaccagaag
gcatttgaacaccttgggaatgcactgacttacgaccctgccaactacaaggccatcttg
gcagcaggcagcatgatgcagactcatggggactttgatgttgcccttaccaaatacaga
gttgtagcttgtgctattccagaaagtcctccactttggaataacattggaatgtgtttc
tttggcaagaagaaatacgtggcagctatcagctgcctaaaacgagccaattacttggca
cccttcgactggaagattctgtacaatctgggccttgtccatttgaccatgcagcagtat
gcatcggcattccactttctcagcgcagccatcaacttccagccaaagatgggggaactc
tacatgctcttggctgtggctctgaccaacctggaagacatagaaaatgccaaaagagct
tatgtagaagctgtccgcctggataagtgcaaccctttagtaaacctgaactacgctgtg
ctgctgtacaaccagggtgagaagaagggtgccttggctcagtaccaggagatggagaag
aaggtccattttctcaaggacaacaatcctctggaatttgattctgagatggtagagatg
gctcagaagttgggagctgccctccaggttggagaggcactggtctggaccaagccagtc
aaagatcccaagtcaaagcaccggaccaattcaggcagcaaatctgctactctccagcag
cctctgggctcctttcaagctcttggacaggcgatgtcttcggcagctgcacacaggaag
atcccttcaggtgctgtaggagcccagctcacaaagccgccatcacttccactggagcca
gagccagagcccactgtggaggcgagtccaacagaagcatcagaacaaaacaaagaaaaa
tag

DBGET integrated database retrieval system