KEGG   Rattus norvegicus (rat): 300756Help
Entry
300756            CDS       T01003                                 

Gene name
Arih1
Definition
(RefSeq) ariadne RBR E3 ubiquitin protein ligase 1
  KO
K11968  ariadne-1 [EC:2.3.2.31]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    300756 (Arih1)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.31  RBR-type E3 ubiquitin transferase
     300756 (Arih1)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   RBR proteins
    300756 (Arih1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IBR zf-C3HC4_2 zf-C3HC4 zf-RING_5 zf-RING_UBOX zf-RING_14 zf-RING_2 zf-C3HC4_4
Motif
Other DBs
NCBI-GeneID: 300756
NCBI-ProteinID: NP_001013126
RGD: 1308131
Ensembl: ENSRNOG00000009887
UniProt: Q5XI15 D3ZXL1
Position
8q24
AA seq 555 aa AA seqDB search
MDSDEGYNYEFDEDEECSEEDSGAEEEEDDDEDEPDDDNLDLGEVELVEPGLGVGGERDG
LLCGETGGGGGSALGPGGGGGGGGGGGGPGHEQEEDYRYEVLTAEQILQHMVECIREVNE
VIQNPATITRILLSHFNWDKEKLMERYFDGNLEKLFAECHVINPSKKSRTRQMNTRSSAQ
DMPCQICYLNYPNSYFTGLECGHKFCMQCWSEYLTTKIMEEGMGQTISCPAHGCDILVDD
NTVMRLITDSKVKLKYQHLITNSFVECNRLLKWCPAPDCHHVVKVQYPDAKPVRCKCGRQ
FCFNCGENWHDPVKCKWLKKWIKKCDDDSETSNWIAANTKECPKCHVTIEKDGGCNHMVC
RNQNCKAEFCWVCLGPWEPHGSAWYNCNRYNEDDAKAARDAQERSRAALQRYLFYCNRYM
NHMQSLRFEHKLYAQVKQKMEEMQQHNMSWIEVQFLKKAVDVLCQCRATLMYTYVFAFYL
KKNNQSIIFENNQADLENATEVLSGYLERDISQDSLQDIKQKVQDKYRYCESRRRVLLQH
VHEGYEKDLWEYIED
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atggactcggacgagggctacaactacgagttcgacgaggacgaggagtgcagcgaggag
gacagcggcgccgaggaggaggaggacgacgacgaggatgagccggacgatgataacctg
gatctcggcgaggtggagctggtggagcccgggctgggcgtcggcggggagcgggacgga
ctgctgtgcggggagactggcggcggcggcggcagcgctctgggtcccggaggcggtggc
ggcggtggcggtggcggcggcggcccggggcacgagcaggaggaagattaccgctacgag
gtgctcacggccgaacagatcctgcagcacatggtggaatgtatccgggaggtcaacgag
gtcatccagaatccagcaactatcacgagaatactccttagccacttcaattgggataaa
gagaagctaatggaaaggtactttgatggaaacctggagaagctctttgctgagtgtcat
gtaattaatccaagtaaaaagtctcgaactcgccagatgaatacaaggtcatcagcacag
gatatgccttgtcagatctgctacttgaattaccctaactcgtattttactggccttgaa
tgtggacataagttttgtatgcagtgctggagtgaatatttaactaccaaaataatggaa
gaaggcatggggcagactatctcgtgtcctgcgcatggctgtgatatcttagtggatgac
aacacagttatgcgcctgatcacagattcaaaagttaaattaaaatatcagcatttaata
acaaatagctttgtagagtgcaaccgactgttaaaatggtgtcctgcccccgattgccac
catgttgttaaagtccagtatcctgatgcaaaaccagttcgctgcaagtgtggccgccag
ttttgctttaactgtggcgaaaattggcatgatccagttaaatgtaagtggttgaagaag
tggattaaaaagtgtgatgatgacagtgaaacttctaattggattgcagctaacacaaag
gaatgtcccaaatgccatgtcacaattgagaaggatggtggttgtaatcacatggtctgt
cgtaaccagaactgtaaagcagagttttgctgggtgtgtcttggcccttgggaaccacat
ggatctgcctggtacaactgtaaccgctataatgaggatgatgcaaaggcagcaagagat
gcccaagagcgatctagggcagccctgcagaggtacctgttctactgtaatcgctatatg
aaccacatgcagagtctacgctttgagcataagctgtatgctcaggtgaaacagaagatg
gaggaaatgcagcagcacaacatgtcctggattgaggtgcagttcctgaagaaagcagtt
gatgtcctctgccagtgtcgtgccacactcatgtacacttatgtcttcgctttctacctc
aaaaagaataaccagtccattatctttgagaataatcaagcagatctagaaaatgccaca
gaggtgctttcgggctaccttgaacgagatatttcccaagattctctgcaagatataaag
cagaaagtccaagataagtacagatactgtgagagtcgacgaagggttttgttacagcat
gtgcatgaaggctatgaaaaagatctgtgggagtacattgaggactga

DBGET integrated database retrieval system