KEGG   Rattus norvegicus (rat): 300768Help
Entry
300768            CDS       T01003                                 

Gene name
Coro2b
Definition
(RefSeq) coronin 2B
  KO
K13887  coronin-2
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    300768 (Coro2b)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     300768 (Coro2b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF1899 WD40_4 WD40 ANAPC4_WD40 Sec2p DivIC
Motif
Other DBs
NCBI-GeneID: 300768
NCBI-ProteinID: XP_001074062
RGD: 1561953
Ensembl: ENSRNOG00000015257
UniProt: F1LMV9
Position
8q24
AA seq 480 aa AA seqDB search
MTVTKMSWRPQYRSSKFRNVYGKVANREHCFDGIPITKNVHDNHFCAVNARFLAIVTESA
GGGSFLVIPLEQTGRIEPNYPKVCGHQGNVLDIKWNPFIDNIIASCSEDTSVRIWEIPEG
GLKRNMTEALLELHGHSRRVGLVEWHPTTNNILFSAGYDYKVLIWNLDIGEPVKMIDCHT
DVILCMSFNTDGSLLTTTCKDKKLRVIEPRSGRVLQEANCKNHRVNRVVFLGNMKRLLTT
GVSRWNTRQIALWDQEDLSMPMIEEEIDGLSGLLFPFYDADTHMLYLAGKGDGNIRYYEI
STEKPYLSYLMEFRSPAPQKGLGVMPKHGLDVSACEVFRFYKLVTLKGLIEPISMIVPRR
SDSYQEDIYPMTPGTEPALTPDEWLGGVNRDPVLMSLKEGYKKSSKVVFKAPIREKKSVV
VNGIDLLENVPPRTENELLRMFFRQQDEIRRLKEELAQKDIRLRQLQLELKNLRNNPKNC
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgactgtcacaaagatgtcctggcgaccgcagtaccgaagttccaagtttcggaacgtg
tacgggaaagtggccaacagggagcactgctttgacgggatccccatcaccaagaacgtc
cacgacaaccacttctgtgcagtcaatgcccgcttcctggccatagtcactgagagtgca
ggaggtggttccttcctcgtcatccccctggagcagacaggcagaatcgagccaaactac
cccaaggtgtgtggtcatcaaggcaatgtgctggacatcaaatggaaccccttcattgac
aacatcatcgcctcctgctctgaggacacttcggtgcggatctgggagatccctgagggc
gggctgaagcggaacatgaccgaggctctcctggagctccacggacacagccgccgtgtg
gggctggttgagtggcaccccacaactaacaacattctgttcagtgctggctatgactac
aaggtcctcatctggaacctggacataggagagccagtgaaaatgattgactgtcacaca
gatgtgatcctctgcatgtccttcaacacagacggcagcctgctcaccaccacgtgcaaa
gacaagaagcttcgcgtgattgagccccgctctggccgtgttctgcaggaggcaaactgc
aaaaaccacagagtgaaccgggtagtgttcctgggcaacatgaagcggctcctcacgaca
ggggtctccaggtggaacaccagacagattgccctctgggaccaggaggatctgtccatg
ccaatgatcgaggaagaaattgatggactctcaggcctcctgttcccattctatgatgct
gacacccacatgctctacctggctggaaagggggatggaaacatccggtactatgagatc
agcacggagaagccctacctgagctacctcatggagttccgctccccagccccacagaaa
ggcctaggtgtcatgcccaagcatgggttggatgtgtctgcttgcgaggtcttccgcttc
tacaagctcgtgactctcaagggcctaattgaacccatctccatgattgtgccccggagg
tcagattcctaccaggaggacatttaccccatgacgccaggcacagagccagcgctgacc
cctgatgaatggctgggaggcgtcaaccgagatcccgtgctgatgtctctgaaggaaggc
tataagaagtcttcaaaagtggtatttaaggcccccatcagagaaaagaagagcgtcgtc
gtcaacggcatagatttattagaaaatgtccctcccaggacagagaatgagctcctcagg
atgttcttcaggcagcaggatgagattcggaggctgaaggaggagttggcacagaaggac
atccggctccgtcagctccagctcgaactgaaaaatctgcgcaacaaccccaagaactgc
tag

DBGET integrated database retrieval system