KEGG   Rattus norvegicus (rat): 300790
Entry
300790            CDS       T01003                                 

Gene name
Slc51b, Ostb, Ostbeta, RGD1565748
Definition
(RefSeq) solute carrier family 51, beta subunit
  KO
K14361  organic solute transporter subunit beta
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04976  Bile secretion
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    300790 (Slc51b)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    300790 (Slc51b)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC51: Transporter of steroid-derived molecules
   300790 (Slc51b)
SSDB
Motif
Pfam: OSTbeta
Other DBs
NCBI-GeneID: 300790
NCBI-ProteinID: XP_001076555
RGD: 1565748
Ensembl: ENSRNOG00000028889
UniProt: D3ZYJ2
Position
8q24
AA seq 127 aa
MDHSAEGAAASAEVPQELLEEMLWYFRSEDATPWNYSILVLAVLVMVIGVVLLRRSILAN
RNRKKQPQDNGMPEDLHLDDSMKENSSLGILRETLISEKADLAPGETELNKRETSVVFLP
DPQETES
NT seq 384 nt   +upstreamnt  +downstreamnt
atggaccacagtgcagaaggagctgcagccagtgccgaggtgccccaggagctgctggag
gaaatgctttggtatttccgttcagaggatgcaactccttggaactattccatcctggtt
ctggcagtcctggtgatggtgataggcgtggtcctcctgagaaggagcatcctggcaaac
agaaatcgaaagaagcagccacaagacaacggaatgccagaagacctgcatctagatgat
tccatgaaagaaaacagcagcctgggcatcctaagagagacgctgatctcagagaaggca
gacttggccccaggggaaaccgagttgaacaagagagagacatcagtcgtctttctacca
gacccccaggaaactgagagctag

DBGET integrated database retrieval system