KEGG   Rattus norvegicus (rat): 300799Help
Entry
300799            CDS       T01003                                 

Gene name
Dapk2
Definition
(RefSeq) death-associated protein kinase 2
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr
Motif
Other DBs
NCBI-GeneID: 300799
NCBI-ProteinID: NP_001013127
RGD: 1304708
UniProt: Q5BJN2
Position
8q24
AA seq 215 aa AA seqDB search
MLLDKNIPIPHIKLIDFGLAHEIEDGVEFKNIFGTPEFVAPEIVNYEPLGLEADMWSIGV
ITYILLSGASPFLGDTKQETLANITAVSYDFDEEFFSQTSELAKDFIRKLLVKETRKRLT
IQEALRHPWIMPVDNQQAMVRRESVVNLENFKKQYVRRRWKLSFSIVSLCNHLTRSLMKK
VHLRTSEDLRNCESDTEENIARRKALHPRRRSSTS
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgttgttagacaagaatatccccattccacacatcaagctgattgactttggcttggct
cacgaaatagaagatggagttgaatttaaaaacatttttgggacacctgaatttgttgct
ccagaaatcgtgaactatgagccactgggactggaggcagacatgtggagcatcggagtc
atcacctacatccttctaagtggagcatcccccttcctgggagacacaaagcaagaaacc
ctggcaaacatcactgctgtgagttacgactttgacgaggaattcttcagccagaccagt
gagctggccaaggacttcattcggaagcttcttgtgaaggagacccggaaacggcttacc
atccaagaggctctcaggcatccctggatcatgccagtggacaaccagcaagccatggtg
cgcagagagtctgtggtcaacctggagaactttaagaagcagtatgtccgcaggcggtgg
aagctgtccttcagcatcgtctccctgtgcaaccacctcactcgctccctgatgaagaag
gtgcacttgaggacaagtgaggacctgaggaactgcgagagtgacacggaggagaacatt
gccaggaggaaagcccttcacccccggaggaggagcagtacctcctaa

DBGET integrated database retrieval system