KEGG   Rattus norvegicus (rat): 300807
Entry
300807            CDS       T01003                                 

Gene name
Rora
Definition
(RefSeq) nuclear receptor ROR-alpha isoform X3
  KO
K08532  RAR-related orphan receptor alpha
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04659  Th17 cell differentiation
rno04710  Circadian rhythm
rno05017  Spinocerebellar ataxia
rno05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    300807 (Rora)
  09159 Environmental adaptation
   04710 Circadian rhythm
    300807 (Rora)
 09160 Human Diseases
  09163 Immune disease
   05321 Inflammatory bowel disease
    300807 (Rora)
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    300807 (Rora)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    300807 (Rora)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:rno03310]
    300807 (Rora)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Zinc finger
   Cys4 thyroid hormone receptor-like
    300807 (Rora)
Nuclear receptors [BR:rno03310]
 1. Thyroid hormone like
  1F. RAR-related orphan receptor
   300807 (Rora)
SSDB
Motif
Pfam: zf-C4 Hormone_recep
Other DBs
NCBI-GeneID: 300807
NCBI-ProteinID: XP_008764632
RGD: 1308419
Ensembl: ENSRNOG00000027145
UniProt: F1LZZ3
Position
8
AA seq 467 aa
MYFVIAAMKAQIEIIPCKICGDKSSGIHYGVITCEGCKGFFRRSQQSNATYSCPRQKNCL
IDRTSRNRCQHCRLQKCLAVGMSRDAVKFGRMSKKQRDSLYAEVQKHRMQQQQRDHQQQP
GEAEPLTPTYNISANGLTELHDDLSTYMDGHTPEGSKADSAVSSFYLDIQPSPDQSGLDI
NGIKPEPICDYTPASGFFPYCSFTNGETSPTVSMAELEHLAQNISKSHLETCQYLREELQ
QITWQTFLQEEIENYQNKQREVMWQLCAIKITEAIQYVVEFAKRIDGFMELCQNDQIVLL
KAGSLEVVFIRMCRAFDSQNNTVYFDGKYASPDVFKSLGCEDFISFVFEFGKSLCSMHLT
EDEIALFSAFVLMSADRSWLQEKVKIEKLQQKIQLALQHVLQKNHREDGILTKLICKVST
LRALCGRHTEKLMAFKAIYPDIVRLHFPPLYKELFTSEFEPAMQIDG
NT seq 1404 nt   +upstreamnt  +downstreamnt
atgtattttgtgatcgcagcgatgaaagctcaaattgaaattattccatgcaagatctgt
ggagacaaatcgtcaggaatccattatggtgtcattacgtgtgaaggctgcaagggcttt
ttcaggagaagtcagcagagcaatgccacctactcctgtcctcggcagaagaactgtttg
atcgataggaccagcagaaaccgctgccagcactgccggctgcagaagtgcctggctgtg
gggatgtctcgagatgctgtcaagtttggccggatgtccaagaagcaaagagacagcctg
tacgccgaggtgcagaagcaccggatgcagcagcagcagcgagaccaccagcagcaacct
ggggaggctgagccgctgacgcccacctacaacatctcagccaatgggctgacggaactg
catgatgacctcagcacctacatggacggccacacccccgagggcagcaaggccgactca
gctgtcagcagcttctacctggacatccagccctccccagaccagtcgggactggacatc
aatgggatcaaacccgaacccatatgtgactacacaccagcatctggcttcttcccctac
tgttccttcaccaacggagagacttccccaaccgtgtccatggcggaactagaacacctt
gcacagaacatatccaaatcgcacctggaaacctgccaatacttgcgggaagagctccag
cagataacgtggcagaccttcctgcaggaggagattgagaactaccagaacaagcagaga
gaggtgatgtggcagttgtgtgctatcaagattacagaagctatccagtatgtggtggag
ttcgccaaacgcatcgacgggtttatggagctgtgtcaaaatgatcaaattgtgcttcta
aaagcaggctctctagaggtggtgtttattaggatgtgccgtgcctttgactctcagaac
aacaccgtgtactttgatgggaagtatgctagccccgatgtcttcaaatccttaggttgt
gaagacttcattagctttgtgtttgaatttgggaagagtttgtgttctatgcatctgact
gaagacgaaatcgcattgttttctgcatttgtactgatgtcagcagatcgctcctggctt
caggaaaaggtaaaaatagaaaaactgcaacagaaaattcagctagcccttcaacatgtc
cttcagaagaaccaccgagaagatggaattctaacaaagctaatatgcaaggtgtctacg
ttaagagccctatgcggacgacatacagaaaagctaatggcatttaaagcaatataccca
gacattgtgcgactccattttcctccgttatacaaggaattgttcacttcagaatttgag
ccagcaatgcaaatcgatgggtaa

DBGET integrated database retrieval system