KEGG   Rattus norvegicus (rat): 300826
Entry
300826            CDS       T01003                                 

Gene name
Khdc3, Ecat1, RGD1311617
Definition
(RefSeq) KH domain containing 3, subcortical maternal complex member
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: MOEP19
Other DBs
NCBI-GeneID: 300826
NCBI-ProteinID: NP_001100307
RGD: 1311617
Ensembl: ENSRNOG00000054460
UniProt: D3ZVV1
Position
8q24
AA seq 434 aa
MATLKTFRTLVQLKHKLGKAYEIVGEPRLPKWFHVEYLEDPKKMYVEPTLVEIMFGKDGE
HIPHVECTLHVLIHVNVWGPEKQAEILIFGPPNFQKDVAQMLSNVAHFCRMKLMEKEALE
AGVERRLMAASKATTQPTPVKVRDAATQVAPVQVRDAAIQPAPVKVRDAATQVAPVQVHE
VATQPVPVQVRDAATQPVPVRVRDAATQPVPVRVRDAATQPVPVRVRDAATQPVPVRVRD
AATEPVPVQVRDAATQPAPVQVRDAATQPAPVQVRDAATQPAPVQVRDAATQPAPVQVRD
AATQPAPVQVRDAATQPAPVQVRDAATQPAPVQVREAATQQTPVEVADDTQLVQLKAGEA
FAQHTSGKVHQDVNGQSPIEVCEGATQRHSVDASEALSQKCPEDLEGGDTETSLDDSYVI
IRPSRAVWEPFVML
NT seq 1305 nt   +upstreamnt  +downstreamnt
atggccactctgaagacgtttcggacgctcgttcagctgaagcacaaactaggtaaagcc
tatgaaattgtcggagagcccaggctgcccaagtggttccatgtcgagtacctggaagat
ccaaaaaaaatgtacgtggaacctacgctagtggaaatcatgtttggaaaggacggagag
cacatcccgcatgttgagtgtacgttgcatgtcctgattcacgtgaacgtctggggcccc
gaaaagcaagctgagattttgatattcggaccgcctaattttcaaaaggacgtggctcag
atgctttctaacgtggctcacttctgccgcatgaagttgatggaaaaggaggctctggag
gctggagttgagcgtcgtcttatggccgccagtaaggcgaccacccagccgactcccgtg
aaggtccgcgacgctgccacccaggtggctccggtgcaggtccgcgacgctgccatccag
ccggctcccgtgaaggtccgcgacgctgccacccaggtggctccggtgcaggtccacgag
gtagccacccagcccgttcccgtgcaggtccgcgacgctgccacccagcccgttcccgtg
cgggtccgcgacgctgccacccagcccgttcccgtgcgggtccgcgacgctgccacccag
cccgttcccgtgcgggtccgcgacgctgccacccagcccgttcccgtgcgggtccgcgac
gctgccaccgagcccgttcccgtgcaggtccgcgacgctgccactcagcccgctcccgtg
caggtccgcgacgctgccacccagccggctccggtgcaggtccgcgacgctgccacccag
ccggctccggtgcaggtccgcgacgctgccacccagccggctccggtgcaggtccgcgac
gctgccacccagccggctccggtgcaggtccgcgacgctgccacccagccggctccggtg
caggtccgcgacgctgccactcagccggccccggtgcaggtccgtgaggctgccacgcag
cagactcccgtggaggtcgctgatgatacccagttggttcagttgaaggctggtgaagcc
ttcgcccagcacacttcagggaaagtccaccaggatgtcaatgggcagtctcccattgaa
gtctgtgagggtgccacccagcggcattctgtagatgcctctgaggccttgtcccagaag
tgtcctgaggatcttgaggggggggataccgagacttccttggatgacagctatgtcata
attcgcccttcaagagctgtctgggaaccctttgtcatgttataa

DBGET integrated database retrieval system