KEGG   Rattus norvegicus (rat): 300850Help
Entry
300850            CDS       T01003                                 

Gene name
Gsta4
Definition
(RefSeq) glutathione S-transferase alpha 4
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00480  Glutathione metabolism
rno00980  Metabolism of xenobiotics by cytochrome P450
rno00982  Drug metabolism - cytochrome P450
rno00983  Drug metabolism - other enzymes
rno01100  Metabolic pathways
rno01524  Platinum drug resistance
rno05200  Pathways in cancer
rno05204  Chemical carcinogenesis
rno05225  Hepatocellular carcinoma
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    300850 (Gsta4)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    300850 (Gsta4)
   00982 Drug metabolism - cytochrome P450
    300850 (Gsta4)
   00983 Drug metabolism - other enzymes
    300850 (Gsta4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    300850 (Gsta4)
   05204 Chemical carcinogenesis
    300850 (Gsta4)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    300850 (Gsta4)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    300850 (Gsta4)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    300850 (Gsta4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    300850 (Gsta4)
Enzymes [BR:rno01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     300850 (Gsta4)
Transporters [BR:rno02000]
 Other Transporters
  Pores ion channels [TC:1]
   300850 (Gsta4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_C_3 GST_C GST_N GST_C_2 GST_N_3
Motif
Other DBs
NCBI-GeneID: 300850
NCBI-ProteinID: NP_001100310
RGD: 1309970
Ensembl: ENSRNOG00000030449
UniProt: P14942 A9UMW1
Position
8q31
AA seq 222 aa AA seqDB search
MEVKPKLYYFQGRGRMESIRWLLATAGVEFEEEFLETREQYEKLQKDGCLLFGQVPLVEI
DGMLLTQTRAILSYLAAKYNLYGKDLKERVRIDMYADGTQDLMMMIIGAPFKAPQEKEES
LALAVKRAKNRYFPVFEKILKDHGEAFLVGNQLSWADIQLLEAILMVEEVSAPVLSDFPL
LQAFKTRISNIPTIKKFLQPGSQRKPPPDGHYVDVVRTVLKF
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atggaagtcaaacccaagctctactactttcaaggcaggggaaggatggagtcgatccgc
tggctgctggctacagctggagtggagtttgaagaagaatttcttgagacgagagaacaa
tatgagaagttgcaaaaggatggatgcctgctttttggccaagtcccattggtggaaata
gacgggatgctactgacacagaccagagccatcctcagctacctggccgccaagtacaac
ttgtatgggaaggacctgaaggagagagtcaggattgacatgtatgccgatggcacccag
gacctgatgatgatgattatcggggctccatttaaagcccctcaggaaaaagaagagagc
ctagctttagcagtgaagagggctaaaaaccgttacttcccagtgtttgaaaagatttta
aaagaccatggagaggcatttcttgttggcaaccaactcagttgggcagacatacagcta
ctagaagccattttgatggtggaagaagtcagtgctcctgtgttgtctgacttccctctg
ctgcaggcatttaagacaagaatcagcaacattcctacaattaagaagttcctgcaacct
ggaagtcagaggaagccacctccggatggccactatgttgacgtggtcaggaccgtcctg
aagttctag

DBGET integrated database retrieval system