KEGG   Rattus norvegicus (rat): 300857
Entry
300857            CDS       T01003                                 

Gene name
Tmem30a
Definition
(RefSeq) transmembrane protein 30A
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: CDC50
Other DBs
NCBI-GeneID: 300857
NCBI-ProteinID: NP_001004248
RGD: 1303315
Ensembl: ENSRNOG00000010895
UniProt: Q6AY41
Position
8q31
AA seq 328 aa
MAMNYSAKDEVDGGPTGPPGGAAKTRRPDNTAFKQQRLPAWQPILTAGTVLPTFFIIGLI
FIPIGIGIFVTSNNIREIEGNVFMYYGLSNFYQNHRRYVKSRDDSQLNGDPSALLNPSKE
CEPYRRNEDKPIAPCGAIANSMFNDTLELFLVANESDPKPVPILLKKKGIAWWTDKNVKF
RNPPGKDSLQEKFKDTTKPVNWHKPVYELDPDDESNNGFINEDFIVWMRTAALPTFRKLY
RLIERTDDLHPTLPAGQYYLNITYNYPVHFFDGRKRMILSTISWMGGKNPFLGIAYITIG
SISFLLGVVLLVINHKYRNSSNTADITI
NT seq 987 nt   +upstreamnt  +downstreamnt
atggcgatgaactatagcgcgaaggatgaggtggacggcgggcccacgggtcctccgggg
ggcgccgccaagacccggaggccggataacacggccttcaaacagcaacggttgcctgcc
tggcagcccatcctcaccgccggcacggtgctgcccaccttcttcatcatcggcctcatc
ttcattcccatcggcatcggcatcttcgtcacctccaacaacatccgtgagatcgagggc
aatgtgtttatgtattatggactgtctaatttctatcaaaaccatcgtcgttatgtgaaa
tcccgagatgatagccagttaaacggagaccctagtgctttgcttaatccaagtaaggaa
tgtgaaccctatcgaagaaatgaagacaaaccgattgctccatgtggggccattgccaac
agcatgtttaacgatacgttagagttgtttctggttgccaatgaatctgatcccaagcct
gtgccaattcttttgaagaaaaaaggtattgcttggtggacagataaaaatgtgaaattc
agaaatccacctggaaaagacagccttcaagaaaagtttaaagatacaacaaagccagta
aactggcataaaccagtatatgagctagaccctgatgatgaaagtaataatggattcata
aatgaagactttattgtttggatgcgtactgcagctttacctacttttcgtaagttatat
cgtcttatagagcggacagatgatttacacccaacactaccagctggacagtactatttg
aacatcacatacaattaccctgtacatttttttgatggacgaaaacggatgatcttgagc
actatttcatggatgggaggaaagaatccatttttgggaattgcttacatcactattgga
tccatctccttccttctgggagttgtactgctagtaattaatcataaatatagaaacagt
agtaatactgctgacatcaccatttaa

DBGET integrated database retrieval system