KEGG   Rattus norvegicus (rat): 300870
Entry
300870            CDS       T01003                                 

Gene name
Fam46a, RGD1311381
Definition
(RefSeq) family with sequence similarity 46, member A
  KO
K23033  terminal nucleotidyltransferase 5A/B [EC:2.7.7.-]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    300870 (Fam46a)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.-  
     300870 (Fam46a)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA processing factors
   Other processing factors
    300870 (Fam46a)
SSDB
Motif
Pfam: NTP_transf_7
Other DBs
NCBI-GeneID: 300870
NCBI-ProteinID: NP_001100314
RGD: 1311381
Ensembl: ENSRNOG00000010240
UniProt: D3ZH34
Position
8q31
AA seq 446 aa
MHQRYFWTDQGQVAFGGHYMAESEGYFAMAEDELTGGPYIPLGGDFGGGGSFGDRCSDYC
ESPTAHCNVLNWEQVQRLDGILSETIPIHGRGNFPTLELQPSLIVKVVRRRLEEKSIGVR
DVRLNGSAASHVLHQDSGLGYKDLDLIFCADLRGEEEFQTVKDVVLDCLLDFLPEGVNKE
KITPLTLKEAYVQKMVKVCNDSDRWSLISLSNNSGKNVELKFVDSLRRQFEFSVDSFQIK
LDSLLLFYECSENPMTETFHPTIIGESVYGDFHEAFDHLCNKIIATRNPEEIRGGGLLKY
CNLLVRGFRPASEEIKTLQRYMCSRFFIDFSDIGEQQRKLESYLQNHFVGLEDRKYDYLM
TLHGVVNESTVCLMGHERRQTLNLITMLAIRVLADQNVIPNVANVTCYYQPAPYVADANF
SNYYIAQVQPVFTCQQQTYSTWLPCN
NT seq 1341 nt   +upstreamnt  +downstreamnt
atgcatcagagatacttttggactgaccaaggccaagtggcgttcggcgggcactacatg
gctgagagcgaagggtactttgccatggcagaggacgagctgaccggcggcccctacatc
cctctgggtggtgacttcggcggcggtggcagcttcggcgaccgctgctcggactattgc
gaaagccccacggcgcactgcaacgtgctgaactgggagcaagtgcagcggttggacggc
attttgagcgagaccatcccgatccacggtcgcggcaacttccccacgctcgagctgcag
ccgagcctgattgtgaaggtggtgcggaggcgcctggaggagaagagcataggtgtccgc
gacgtgcgcctcaacggctcggccgccagtcacgtcctgcaccaagacagcggcctgggc
tacaaggatctggacctcatcttctgcgccgacctgcgtggggaagaagagtttcagact
gtgaaggacgtcgtgctggattgcctgttagacttcttgcccgaaggggtgaacaaggag
aagatcacgccgctcactctcaaggaagcgtatgtgcagaaaatggttaaagtgtgcaat
gattctgaccggtggagccttatatccctgtcaaacaacagcggcaaaaatgtggagctg
aagtttgtggattccctccggaggcagtttgaattcagtgtagattcttttcaaatcaaa
ttagactctcttctcctcttttacgagtgttcagagaacccaatgaccgagacatttcac
cccaccataatcggcgagagtgtctacggtgatttccacgaagccttcgatcacctttgc
aacaagatcattgccaccagaaaccccgaggaaataagaggaggaggcctgcttaagtac
tgcaacctcttagtgcggggcttcaggcctgcctctgaggagatcaagacccttcagagg
tacatgtgttccaggttctttattgacttctcagacatcggagagcagcagagaaagctg
gaatcctacttgcagaaccacttcgtgggcttggaagaccgcaagtatgactatctcatg
accctccacggagtggtaaacgagagtacggtgtgcctgatgggacatgagagaaggcag
actttaaaccttatcaccatgctggcaatccgggtgctagctgaccaaaatgtcattcct
aatgtggctaatgtcacttgctattaccagccggccccctatgtcgcagatgctaacttt
agcaattactacatcgcacaggttcagccagtattcacatgccagcagcagacgtattct
acttggttaccctgcaattaa

DBGET integrated database retrieval system