KEGG   Rattus norvegicus (rat): 300888
Entry
300888            CDS       T01003                                 

Gene name
Tmed3
Definition
(RefSeq) transmembrane emp24 domain-containing protein 3 precursor
  KO
K20350  p24 family protein gamma-4
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    300888 (Tmed3)
Membrane trafficking [BR:rno04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   p24 family proteins
    300888 (Tmed3)
SSDB
Motif
Pfam: EMP24_GP25L
Other DBs
NCBI-GeneID: 300888
NCBI-ProteinID: NP_001004249
RGD: 1303327
Ensembl: ENSRNOG00000013889
UniProt: Q6AY25
Position
8
AA seq 221 aa
MGNEVPRASSFQMLMLLLLLLLLRAERLRGAELTFELPDNAKQCFHEEVEQGVKFSLDYQ
VITGGHYDVDCYVEDPMGNIIYRETKKQYDSFTYKTEVKGVYRFCFSNEFSTFSHKTVYF
DFQVGDEPPILPDMGNRVTALTQMESACVTIHEALKTVIDSQTHYRLREAQDRARAEDLN
SRVSYWSVGETIALFVVSFSQVLLLKSFFTEKRPINRAVHS
NT seq 666 nt   +upstreamnt  +downstreamnt
atgggcaacgaggttccgcgcgcttcatccttccagatgctgatgctgctgctgctcttg
ctcctgctccgggccgagcgactgcggggcgctgagctcaccttcgagctgccggacaac
gccaagcagtgcttccacgaagaggtggagcagggcgtgaagttctctctggattaccag
gttatcaccggaggccactacgatgtggactgctatgtggaagaccccatgggcaatatc
atctacagggagacaaagaagcagtatgacagcttcacatacaagacggaggtcaagggc
gtttaccggttctgcttcagtaacgagttctccactttctctcacaagactgtctacttt
gacttccaagtgggtgacgagccccccattctcccagacatggggaatagggtcacagct
ctcactcagatggagtctgcctgcgtaacgattcacgaggctctgaagactgtgatcgac
tcccagacacattatcgactgcgggaggctcaggaccgagcccgagctgaagaccttaat
agtcgagtgtcttactggtctgtaggagagactattgccctgtttgtggtcagcttcagc
caggtgctactgctgaaaagcttctttacagaaaaacgacccattaacagagctgtccac
tcctaa

DBGET integrated database retrieval system