KEGG   Rattus norvegicus (rat): 300891
Entry
300891            CDS       T01003                                 

Gene name
Morf4l1
Definition
(RefSeq) mortality factor 4 like 1
  KO
K11339  mortality factor 4-like protein 1
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    300891 (Morf4l1)
   03400 DNA repair and recombination proteins [BR:rno03400]
    300891 (Morf4l1)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    TIP60 complex
     300891 (Morf4l1)
    NuA4 complex
     300891 (Morf4l1)
DNA repair and recombination proteins [BR:rno03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    Other HR factors
     300891 (Morf4l1)
SSDB
Motif
Pfam: MRG Tudor-knot Fmp27_WPPW
Other DBs
NCBI-GeneID: 300891
NCBI-ProteinID: NP_001011999
RGD: 1307938
Ensembl: ENSRNOG00000058412
UniProt: Q6AYU1
Position
8q31
AA seq 323 aa
MAPKQDPKPKFQEGERVLCFHGPLLYEAKCVKVAIKDKQVKYFIHYSGWNKNWDEWVPES
RVLKYVDANLQKQRELQKANQEQYAEGKMRGAAPGKKTSGLQQKNVEVKTKKNKQKTPGN
GDGGSTSETPQPPRKKRARVDPTVENEETFMNRVEVKVKIPEELKPWLVDDWDLITRQKQ
LFYLPAKKNVDSILEDYANYKKSRGNTDNKEYAVNEVVAGIKEYFNVMLGTQLLYKFERP
QYAEILADHPDAPMSQVYGAPHLLRLFVRIGAMLAYTPLDEKSLALLLNYLHDFLKYLAK
NSATLFSASDYEVAPPEYHRKAV
NT seq 972 nt   +upstreamnt  +downstreamnt
atggcgcccaagcaggacccgaagcctaaattccaggagggcgagcgagtgctgtgcttt
catgggcctcttctttatgaagcaaagtgtgtaaaggttgccataaaggacaaacaagtg
aagtattttatccattacagtggctggaataaaaattgggatgaatgggtgccagaaagc
agagtgctcaaatacgtggacgccaatttgcagaaacagcgggaacttcaaaaggccaac
caggaacaatatgcagagggcaagatgagaggggctgctccagggaagaagacatccggt
ctgcaacagaaaaatgttgaagtgaaaacaaaaaagaacaaacagaaaacacctggaaat
ggagatggtggcagtaccagtgagacccctcagcctcctaggaagaagcgagcccgggta
gatccaaccgttgaaaatgaagaaacattcatgaacagagttgaagttaaagtgaagatt
cctgaggagctgaaaccatggcttgtagatgactgggacttgatcaccagacaaaagcag
cttttttatcttcctgccaagaagaatgtggattccattttggaggattatgcaaactat
aagaagtctcgaggaaatacagataataaggagtatgctgttaatgaggttgtggcaggg
ataaaggagtacttcaatgtaatgttgggcactcagctactctacaaatttgagagacca
cagtatgctgaaattctggccgatcacccggatgcacccatgtcccaggtgtatggagcg
ccacacttactgagattgtttgtgcgaattggagcgatgttggcctatacacctctagat
gagaaaagccttgctttattactgaactatctacatgatttcctcaagtacctggcaaag
aattctgcaactctgttcagtgccagtgattatgaagtggctcctcctgagtaccatcgg
aaagccgtgtga

DBGET integrated database retrieval system