KEGG   Rattus norvegicus (rat): 300901
Entry
300901            CDS       T01003                                 

Gene name
Plod2
Definition
(RefSeq) procollagen lysine, 2-oxoglutarate 5-dioxygenase 2
  KO
K13645  procollagen-lysine,2-oxoglutarate 5-dioxygenase 2 [EC:1.14.11.4]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00310  Lysine degradation
rno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    300901 (Plod2)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.4  procollagen-lysine 5-dioxygenase
     300901 (Plod2)
SSDB
Motif
Pfam: 2OG-FeII_Oxy Anp1 2OG-FeII_Oxy_3 Glycos_transf_2
Other DBs
NCBI-GeneID: 300901
NCBI-ProteinID: NP_001136387
RGD: 3353
Ensembl: ENSRNOG00000030183
UniProt: G3V9I0
Position
8q31
AA seq 737 aa
MGDRGVRLGLLMPMLALLSWAASLGVAEETPSRIPADKLLVITVATKENDGFHRFMNSAK
YFNYTVKVLGQGQEWRGGDGMNSIGGGQKVRLMKEAMEHYAGQDDLVILFTECFDVIFAG
GPEELLKKFQKTNHKIVFAADALLWPDKRLADKYPGVHIGKRYLNSGGFIGYAPYISRLV
QQWDLQDNDDDQLFYTKVYIDPLKREALNITLDHRCKIFQALNGATDEVVLKFENGKSRV
KNTFYETLPVAINGNGPTKILLNYFGNYVPNSWTQENGCALCDFDTIDLSTVDVYPKVTL
GVFIEQPTPFLPRFLDLLLTLDYPKEALRLFVHNKEVYHEKDIKAFVDKAKHDISSIKIV
GPEENLSQAEARNMGMDFCRQDEKCDYYFSVDADVVLTNPRTLKILIEQNRKIIAPLVTR
HGKLWSNFWGALSPDGYYARSEDYVDIVQGNRVGIWNVPYMANVYLIQGKTLRSEMSERN
YFVRDKLDPDMSLCRNARDMGVFMYISNRHEFGRLISTANYNTSHLNNDLWQIFENPVDW
KEKYINRDYSKIFTENIVEQPCPDVFWFPIFSERACDELVEEMEHYGKWSGGKHHDSRIS
GGYENVPTDDIHMKQIDLENVWLHFIREFIAPVTLKVFAGYYTKGFALLNFVVKYSPERQ
RSLRPHHDASTFTINIALNNVGEDFQGGGCKFLRYNCSIESPRKGWSFMHPGRLTHLHEG
LPVKNGTRYIAVSFIDP
NT seq 2214 nt   +upstreamnt  +downstreamnt
atgggggaccgcggagtgaggctggggctgctgatgcccatgctcgccctgctctcctgg
gcggctagcctgggcgtagcggaggagactccctcgcgcatcccagcagataagttatta
gtcataactgtagcaaccaaagaaaacgatggattccacagatttatgaattcagccaag
tatttcaattatactgtgaaggttcttggtcaagggcaagagtggagaggtggtgatggg
atgaacagtattggagggggccagaaggtgagattaatgaaagaagccatggagcactac
gccggtcaggacgatctggtcatcttgtttactgaatgttttgatgttatatttgctggt
gggcctgaagaacttcttaaaaagttccaaaagacaaatcataaaatcgtctttgcagcg
gatgcgctgttgtggccagataagcggctggcagacaagtatcctggtgtgcacattggg
aaacgctacctgaattctggaggctttattggctatgctccctacatcagccgtctggtc
cagcagtgggatctgcaggataatgatgacgaccagctcttttacactaaagtttacatc
gacccgctgaaaagggaagctcttaacatcacattggatcacagatgcaaaattttccag
gccttgaatggagctacagacgaagttgttttaaagtttgaaaatggtaaaagcagagtg
aagaatacattttatgaaacactgccagtggccatcaatgggaatgggcccaccaaaatt
ctcttgaattactttggaaactatgttccaaattcatggacacaggaaaatggctgtgct
ctttgtgactttgacacaattgacctgtctacagtagatgtctatccgaaggtaacacta
ggtgtttttattgaacaaccaaccccctttctacctcggttcctggacttactgttaaca
ctggattaccctaaagaagcacttcgactctttgtccataataaagaagtttatcatgaa
aaggacatcaaagcgtttgttgataaagctaaacacgacatcagctctataaaaatagta
ggaccagaggaaaatctaagtcaagcggaagccagaaacatgggaatggatttctgccgt
caggatgaaaagtgtgattactactttagtgtggatgcagatgttgttttgacaaaccca
agaactttaaaaattttgattgaacaaaacaggaagatcattgcccctcttgtgacacgt
catggaaagttgtggtccaacttctggggagccctgagtcctgatggatactatgctcgt
tctgaagattacgtagatatcgttcagggaaacagagtaggaatatggaatgtcccatac
atggctaatgtgtacttaattcaagggaagacgctgcgatcagagatgagtgaaaggaac
tattttgtgcgtgataagttggatcccgacatgtctctctgccgcaatgctcgagacatg
ggtgtgtttatgtacatttctaacagacatgaatttggacgactgatatcaactgctaat
tacaacacttcccatctcaacaatgacctctggcagatttttgaaaatcccgtggattgg
aaggaaaaatatataaaccgtgactattcaaagattttcactgaaaatatagtcgagcag
ccctgtccagatgtcttctggtttcccatattttctgaacgagcctgtgacgagttggta
gaagaaatggaacattacggcaagtggtccgggggaaagcatcatgacagccgtatatct
ggtggctatgaaaatgtcccaacggatgacattcatatgaagcagattgacctggagaac
gtctggcttcactttatccgagagtttatcgctccagttaccctgaaggtcttcgcggga
tattacaccaagggatttgccctgctgaacttcgtagtgaagtactcgcccgaaagacag
cgctcgctccggcctcaccacgatgcgtcaaccttcaccatcaacattgctctaaataat
gtaggagaggattttcagggaggtggatgcaaattcctaaggtataattgctccatcgaa
tccccccgaaaaggctggagcttcatgcatcctgggaggcttactcatctacacgaaggg
cttcctgtcaaaaatggaacaagatacattgcagtctcatttatcgatccctaa

DBGET integrated database retrieval system