KEGG   Rattus norvegicus (rat): 300965
Entry
300965            CDS       T01003                                 

Gene name
Srprb
Definition
(RefSeq) signal recognition particle receptor subunit beta
  KO
K12272  signal recognition particle receptor subunit beta
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03060  Protein export
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    300965 (Srprb)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:rno02044]
    300965 (Srprb)
   04031 GTP-binding proteins [BR:rno04031]
    300965 (Srprb)
Secretion system [BR:rno02044]
 Sec (secretion) system
  Eukaryotic Sec-SRP protein
   300965 (Srprb)
GTP-binding proteins [BR:rno04031]
 Small (monomeric) G-proteins
  Unclassified
   300965 (Srprb)
SSDB
Motif
Pfam: SRPRB Arf MMR_HSR1 GTP_EFTU Roc FeoB_N Ras G-alpha Dynamin_N Glyco_hydro_3_C S_2TMBeta
Other DBs
NCBI-GeneID: 300965
NCBI-ProteinID: NP_001013270
RGD: 1304698
UniProt: Q4FZX7
Position
8
AA seq 269 aa
MASANTRRVGDGAGGAFQPYLDSLRQELQQRDPTLLSVAVAVLAVLLTLVFWKFIWSRKS
SQRAVLFVGLCDSGKTLLFVRLLTGQYRDTQTSITDSSAIYKVNNNRGNSLTLIDLPGHE
SLRLQFLDRFKSSARAVVFVVDSATFQREVKDVAEFLYQVLIDSMALKNTPAFLVACNKQ
DIAMAKSAKLIQQQLEKELNTLRVTRSAAPSTLDSSSTAPAQLGKKGKEFEFSQLPLKVE
FLECSAKGGRGDAGSADVQDLEKWLAKIA
NT seq 810 nt   +upstreamnt  +downstreamnt
atggcttccgcgaacacccggcgtgttggggatggtgccgggggcgccttccagccttac
ctcgactccttgcgacaggagctgcagcagagggatccgacgctgctgtccgtggcggtg
gcggtactggcggtgctgctgacgctggtgttctggaagttcatttggagccgaaagagc
agtcagagagctgtcctctttgttggtctctgcgactctgggaaaacattgctgttcgtc
aggttgctaacaggccaatacagagacacacagacttctattaccgatagttctgctata
tacaaagtcaacaacaacaggggtaacagcctgactttgattgacctccccgggcacgag
agcttgaggcttcagttcttagatcgctttaagtcttcagccagggctgtggtgttcgtg
gtggacagtgcaacgttccagcgggaggtgaaagatgtggctgagtttctgtaccaggtc
ctcatcgacagcatggctctgaagaacacaccggccttcttagtagcctgcaataagcaa
gatatcgcaatggcaaaatcagcaaagttaattcagcagcagctggagaaggagcttaac
accttgcgagtcacccggtctgctgctcccagcaccctggacagttccagtactgcacct
gctcagctgggaaagaaaggcaaagaatttgaattttcccagttgcccctcaaagtggag
ttcctggagtgtagtgccaagggtggacgaggggatgctggctctgcggacgtccaggac
ttggagaagtggctggccaagatcgcctga

DBGET integrated database retrieval system