KEGG   Rattus norvegicus (rat): 300965Help
Entry
300965            CDS       T01003                                 

Gene name
Srprb, Ab2-417, Ba1-667, Cc1-8
Definition
(RefSeq) SRP receptor beta subunit
  KO
K12272  signal recognition particle receptor subunit beta
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03060  Protein export
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    300965 (Srprb)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:rno02044]
    300965 (Srprb)
   04031 GTP-binding proteins [BR:rno04031]
    300965 (Srprb)
Secretion system [BR:rno02044]
 Sec (secretion) system
  Eukaryotic Sec-SRP protein
   300965 (Srprb)
GTP-binding proteins [BR:rno04031]
 Small (monomeric) G-proteins
  Unclassified
   300965 (Srprb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SRPRB Arf MMR_HSR1 GTP_EFTU Roc FeoB_N Ras Gtr1_RagA G-alpha Dynamin_N Glyco_hydro_3_C S_2TMBeta
Motif
Other DBs
NCBI-GeneID: 300965
NCBI-ProteinID: NP_001013270
RGD: 1304698
UniProt: Q4FZX7
Position
8q32
AA seq 269 aa AA seqDB search
MASANTRRVGDGAGGAFQPYLDSLRQELQQRDPTLLSVAVAVLAVLLTLVFWKFIWSRKS
SQRAVLFVGLCDSGKTLLFVRLLTGQYRDTQTSITDSSAIYKVNNNRGNSLTLIDLPGHE
SLRLQFLDRFKSSARAVVFVVDSATFQREVKDVAEFLYQVLIDSMALKNTPAFLVACNKQ
DIAMAKSAKLIQQQLEKELNTLRVTRSAAPSTLDSSSTAPAQLGKKGKEFEFSQLPLKVE
FLECSAKGGRGDAGSADVQDLEKWLAKIA
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atggcttccgcgaacacccggcgtgttggggatggtgccgggggcgccttccagccttac
ctcgactccttgcgacaggagctgcagcagagggatccgacgctgctgtccgtggcggtg
gcggtactggcggtgctgctgacgctggtgttctggaagttcatttggagccgaaagagc
agtcagagagctgtcctctttgttggtctctgcgactctgggaaaacattgctgttcgtc
aggttgctaacaggccaatacagagacacacagacttctattaccgatagttctgctata
tacaaagtcaacaacaacaggggtaacagcctgactttgattgacctccccgggcacgag
agcttgaggcttcagttcttagatcgctttaagtcttcagccagggctgtggtgttcgtg
gtggacagtgcaacgttccagcgggaggtgaaagatgtggctgagtttctgtaccaggtc
ctcatcgacagcatggctctgaagaacacaccggccttcttagtagcctgcaataagcaa
gatatcgcaatggcaaaatcagcaaagttaattcagcagcagctggagaaggagcttaac
accttgcgagtcacccggtctgctgctcccagcaccctggacagttccagtactgcacct
gctcagctgggaaagaaaggcaaagaatttgaattttcccagttgcccctcaaagtggag
ttcctggagtgtagtgccaagggtggacgaggggatgctggctctgcggacgtccaggac
ttggagaagtggctggccaagatcgcctga

DBGET integrated database retrieval system