KEGG   Rattus norvegicus (rat): 300992Help
Entry
300992            CDS       T01003                                 

Gene name
Cacna2d2
Definition
(RefSeq) calcium voltage-gated channel auxiliary subunit alpha2delta 2
  KO
K04859  voltage-dependent calcium channel alpha-2/delta-2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04260  Cardiac muscle contraction
rno04261  Adrenergic signaling in cardiomyocytes
rno04921  Oxytocin signaling pathway
rno05410  Hypertrophic cardiomyopathy (HCM)
rno05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
rno05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    300992 (Cacna2d2)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    300992 (Cacna2d2)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    300992 (Cacna2d2)
   04261 Adrenergic signaling in cardiomyocytes
    300992 (Cacna2d2)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    300992 (Cacna2d2)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    300992 (Cacna2d2)
   05414 Dilated cardiomyopathy (DCM)
    300992 (Cacna2d2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    300992 (Cacna2d2)
Ion channels [BR:rno04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   300992 (Cacna2d2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: VGCC_alpha2 VWA_N VWA VWA_3 dCache_1 VWA_2 dCache_2 DUF5610 VWA_CoxE
Motif
Other DBs
NCBI-GeneID: 300992
NCBI-ProteinID: NP_783182
RGD: 631360
Ensembl: ENSRNOG00000015835
UniProt: Q8CFG6
Position
8q32
AA seq 1157 aa AA seqDB search
MAVPARTCGASWPGPVRTARPWPGRGPRPCPDPRGPASGPARPLLLLLPPLLLLPLLTAP
GASAYSFPQQHTMQHWARRLEQEIDGVMRIFGGVQQLREIYKDNRNLFDVQENEPQKLVE
KVAGDIESLLDRKVQALKRLADAAENFQKAHRWQDNIKEEDIMYYDAKADAELDDPESED
MERGSKTSALRLDFIEEPNFKNKVNYSYTAVQIPTDIYKGSTVILNELNWTEALENVFIE
NRRQDPTLLWQVFGSATGVTRYYPATPWRAPKKIDLYDVRRRPWYIQGASSPKDMVIIVD
VSGSVSGLTLKLMKTSVCEMLDTLSDDDYVNVASFNEKAQPVSCFTHLVQANVRNKKVFK
EAVQGMVAKGTTGYKAGFEYAFDQLQNSNITRANCNKMIMMFTDGGEDRVQDVFEKYNWP
NRTVRVFTFSVGQHNYDVTPLQWMACTNKGYYFEIPSIGAIRINTQEYLDVLGRPMVLAG
KDAKQVQWTNVYEDALGLGLVVTGTLPVFNLTQDGPGDKKNQLILGVMGIDVALNDIKRL
TPNYTLGANGYVFAIDLNGYVLLHPNLKPQITNFREPVTLDFLDAELEDENKEEIRRSMI
DGDKGHKQIRTLVKSLDERYIDEVIRNYTWVPIRSTNYSLGLVLPPYSTYYLQANLSDQI
LQVKLPISKLKDFEFLLPSSFESEGHVFIAPREYCKDLNASDNNTEFLKNFIELMEKVTP
DSKQCNNFLLHNLILDTGITQQLVERVWRDQDLNTYSLLAVFAATDGGITRVFPNKAAED
WTENPEPFNASFYRRSLDNRGYIFKPPHQDSLLRPLELENDTVGVLVSTAVELSLGRRTL
RPAVVGVKLDLEAWAEKFKVLASNRTHQDQPQKQCGPSSHCEMDCEVNNEDLLCVLIDDG
GFLVLSNQNHQWDQVGRFFSEVDANLMLALYNNSFYTRKESYDYQAACAPQPPGNLGAAP
RGVFVPTIADFLNLAWWTSAAAWSLFQQLLYGLIYHSWFQADPAEAEGSPETRESSCVMK
QTQYYFGSVNASYNAIIDCGNCSRLFHAQRLTNTNLLFVVAEKPLCSQCEVGRLLQKETH
CPADGPEQCELVQRPRYRTGPHICFDYNATEDTSDCGRGASFPPSLGVLVSLQLLLLLGL
PPRPQPQIHSFTPSRRL
NT seq 3474 nt NT seq  +upstreamnt  +downstreamnt
atggcggtgccggctcggacctgcggcgcttcttggcccggcccggtgcggaccgctcgc
ccctggcccggtcgcggtccccggccctgccctgacccccggggcccagcgtccgggccc
gcacgcccgctcttgctactgctgccgcctctgctgcttttaccgctgctcaccgccccc
ggcgcctctgcctacagcttcccccagcagcacacgatgcagcactgggcccggcgcctg
gagcaggagattgacggtgtgatgcggatttttggaggcgtgcagcagctccgagagatc
tacaaggacaatcggaacctgtttgatgtgcaggagaatgaaccacagaaactagtggag
aaggtggcaggggacattgagagcctgctggacagaaaggtccaggccttgaagagactg
gctgacgctgcagagaatttccagaaagcccaccgctggcaagacaacatcaaggaggaa
gacatcatgtactatgacgccaaggctgacgccgagctggatgatcctgagagtgaggat
atggagaggggatccaagaccagcgccttaaggctggacttcatcgaggagccaaacttc
aagaacaaagtcaactattcatacacggcggtgcagatccccacagatatctacaaaggc
tctaccgtcatcctcaatgagcttaactggacggaggccctggagaatgtcttcattgag
aaccgtaggcaagaccctacactgttgtggcaagtcttcggcagtgccacgggagtcacc
cgctattacccagccacaccgtggcgagcccccaagaagattgacctgtacgatgtcaga
agacgaccctggtatatacagggggcctcatcacccaaggacatggtcatcattgtggat
gtgagtggcagtgtgagcggcctgacgctgaagctgatgaagacgtctgtctgtgagatg
ctagacacactctccgatgatgactatgtgaatgtggcctcattcaacgagaaggcgcag
cctgtgtcttgcttcacacacctggtgcaggccaatgtgcggaacaagaaggtgttcaag
gaagctgtgcagggcatggtggccaagggcaccacaggctacaaggctggctttgagtat
gcctttgaccagctacagaattccaacatcacccgtgctaactgcaataagatgatcatg
atgttcacggacgggggagaggatcgcgtgcaggacgtctttgaaaagtataattggccc
aatcggacggtacgcgtcttcacgttctccgtaggacagcataactatgatgtcacaccc
ctgcagtggatggcttgtactaacaaaggttactattttgagatcccttccatcggagcc
atccgcatcaacacacaggaatacctggatgtgctgggtaggcccatggtcctggcaggc
aaggacgccaagcaagtgcaatggacaaacgtgtatgaagatgcgctggggctggggttg
gtggtaacagggactctccctgttttcaacctgacacaggatggccctggggacaagaag
aaccagctaatcctgggtgtcatgggcatagatgtggccctgaatgacatcaaaaggctg
actcccaactacacacttggcgccaatggctacgtgttcgccatcgacctgaatggctat
gtgttgctacatcccaatctcaagccccagattaccaacttccgggagcctgtgaccttg
gacttcctggatgcagagctggaagatgagaacaaggaggagatccgtcgtagtatgatt
gacggagacaaaggccacaagcagatcagaaccttggtcaaatccctggatgagaggtac
atagatgaagtgattcggaactacacctgggtgcctataaggagtaccaactacagcctg
gggctggtgctcccaccctacagcacctactacctccaagccaacctcagcgaccagatc
ctgcaggtcaagttgccaatcagcaaactgaaggattttgagttcctgctccccagcagc
tttgagtctgaaggacatgttttcattgctcccagagagtattgcaaggatttgaatgcc
tcagacaacaacaccgagttcctgaaaaacttcattgagctcatggagaaagtgactccg
gactccaagcagtgcaataacttccttctgcataacttgattttggacacgggcattacg
cagcagttagtggaacgcgtctggcgggaccaagatctcaacacgtacagcctgctagct
gtatttgctgccactgacggtggcatcacacgtgtcttcccgaacaaggcagctgaagac
tggacagaaaaccctgaacccttcaatgccagcttctaccgccgcagcctggataaccgt
ggttatatcttcaagcccccgcaccaggactccctgttaaggccactggagctggagaat
gacacagtaggcgtcctcgtcagcacagctgtagagctcagtctgggtcgccgcacactg
aggccagcagtggtgggtgtcaaactggacctagaggcttgggctgaaaagttcaaggtg
cttgccagcaaccgtacccatcaggaccaacctcagaagcagtgcggccccagcagccac
tgtgagatggactgcgaggtaaacaacgaggacctactctgtgtcctcattgatgacggg
ggattcctggtgctgtcaaaccaaaaccaccagtgggaccaggttggcaggttcttcagt
gaggtggatgccaacctgatgctggcactgtacaataactccttctacaccagaaaggag
tcctatgactatcaggcagcttgtgcccctcagcctcctggcaacctgggtgctgcaccc
aggggtgtctttgtgcccaccattgcagatttccttaacttggcctggtggacctctgct
gccgcctggtccttattccagcaactactttatggtctcatctatcacagctggttccag
gcagacccggcagaagccgagggcagccccgagacgcgcgagagcagctgcgtcatgaaa
caaacccagtactacttcggctcggtgaacgcgtcctataacgccatcatcgactgcgga
aactgcagcaggctgttccacgcgcagagactgaccaacaccaaccttctgttcgtggtg
gcggagaagccgctgtgcagccagtgcgaggtcggccggctgctacaaaaggagacacac
tgcccagcggacggcccggagcagtgtgagctggtgcagagaccgcgataccgaacaggc
ccgcacatctgttttgactacaatgcgacggaagatacctcagactgtggccgcggagcc
tccttccctccgtcgctgggcgtcttggtttccctgcagctgttgctcctcctaggcctg
ccacctcggccgcagcctcaaatccattccttcacgccctctcgccgcctctga

DBGET integrated database retrieval system