KEGG   Rattus norvegicus (rat): 300993
Entry
300993            CDS       T01003                                 

Gene name
Hyal3
Definition
(RefSeq) hyaluronoglucosaminidase 3
  KO
K01197  hyaluronoglucosaminidase [EC:3.2.1.35]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00531  Glycosaminoglycan degradation
rno01100  Metabolic pathways
rno04142  Lysosome
Module
rno_M00076  Dermatan sulfate degradation
rno_M00077  Chondroitin sulfate degradation
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    300993 (Hyal3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    300993 (Hyal3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:rno02042]
    300993 (Hyal3)
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    300993 (Hyal3)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
    300993 (Hyal3)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.35  hyaluronoglucosaminidase
     300993 (Hyal3)
Bacterial toxins [BR:rno02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   300993 (Hyal3)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate / Heparin
  Enzymes
   300993 (Hyal3)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
 Enzymes
  300993 (Hyal3)
SSDB
Motif
Pfam: Glyco_hydro_56 EGF_2 EGF
Other DBs
NCBI-GeneID: 300993
NCBI-ProteinID: NP_997482
RGD: 1303334
Ensembl: ENSRNOG00000016093
UniProt: Q76HM9 A0A0G2JSP4
Position
8q32
AA seq 412 aa
MITQLGLTLVVGLTLCLVHVQALLQVPELPFSVLWNVPSARCKTRFGVHLPLDALGIIAN
HGQRFHGQNITIFYKNQFGLYPYFGPRGTAHNGGIPQAVSLDHHLAQAAHQILHNLGSSF
AGLAVLDWEEWYPLWAGNWGTHRQVYQAASWAWAQQMFPDLNPQEQLHKAQTGFEQAARA
LMEHTLRLGQMLRPHGLWGFYRYPVCGNGWHNMASNYTGHCHPAIITRNTQLRWLWAASS
ALFPSIYLPPRLPPAYHQTFVRHRLEEAFRVALTGHAHPLPVLAYVRLTHRSSGRFLSLD
DLMQTIGVSAALGAAGVVLWGDLSVSSSEEECWRLHDYLVGTLGPYVINVTKAATACSHQ
RCHGHGRCSWKDPGQMEAFLHLQPDDNLGAWKSFRCRCYLGWSGPTCLEPKP
NT seq 1239 nt   +upstreamnt  +downstreamnt
atgatcacgcagctaggcctaaccctggtggtggggttaaccctatgcttggtacacgtc
caggctttgctgcaggttcctgagcttcccttttctgtgctgtggaatgtaccctcagca
agatgtaagacccgctttggtgtgcatctgcctctcgatgctcttggcatcatagccaac
catggccagcgttttcatggccaaaacatcaccatcttctataagaaccagttcggtctt
tatccttactttggacctagaggcacagcccacaatgggggaatccctcaggctgtgtcc
ctagaccaccacttggcacaagctgcccaccagatcctccacaacctaggatctagcttt
gctggcttggcagtgctggactgggaagaatggtacccactctgggctgggaactggggc
acccatcgacaagtctaccaggcagcctcctgggcttgggcacagcagatgttccctgac
ttgaaccctcaggaacagctccacaaagcccaaactggctttgagcaggctgcccgtgca
ctgatggaacacacactgcggctgggccagatgcttcgcccacatgggctctggggcttt
tatcgatacccagtctgtggcaatggctggcataatatggcttccaactacacaggccac
tgccatccagccatcattacccgaaacacccagctgcgttggctctgggctgcctccagt
gctctcttccctagcatctacctcccacccagacttccacctgcctaccatcagaccttt
gtacgacaccgcctggaggaggccttccgtgtagccctcactgggcatgcccatccccta
cctgttctggcttatgttcgcctcacacaccggagctctgggagattcttgtctctggat
gacctaatgcagactattggtgtgagtgcagcactgggagcagctggcgtagtgctctgg
ggggacctgagtgtttctagctctgaggaagagtgctggcgtctccatgactacctagtg
ggcactttaggcccctatgtgatcaacgtgaccaaggctgccacagcctgcagtcaccag
cgatgccatggccacggtcgctgttcctggaaagacccaggacaaatggaagcctttcta
catctgcagccagatgacaatcttggagcttggaagtccttcagatgccgttgttacttg
ggctggtctggccctacctgcctggagcctaaaccctga

DBGET integrated database retrieval system