KEGG   Rattus norvegicus (rat): 301004
Entry
301004            CDS       T01003                                 

Gene name
Qrich1, RGD1311095
Definition
(RefSeq) glutamine-rich 1
  KO
K24297  glutamine-rich protein 1
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    301004 (Qrich1)
SSDB
Motif
Pfam: DUF3504 CARD
Other DBs
NCBI-GeneID: 301004
NCBI-ProteinID: NP_001128004
RGD: 1311095
Ensembl: ENSRNOG00000025071
UniProt: F1M4M7
Position
8q32
AA seq 687 aa
MNNSLENTISFEEYIRVKARSVPQHRMKEFLDSLASKGPEALQEFQQSATTTMVYQQGGN
CIYTDSTEVAGSLLELACPVTTSVQPQTQQEQQIQVQQPQQVQVQVQVQQSPQQVSAQQL
SPQFTVHQPAEQPIQVQVQIQGQAPQSAAPSIQTPSLQSPSPSQLQAAQIQVQHVQAAQQ
IQAAEIPEEHIPHQQIQAQLVAGQSLAGGQQIQIQTVGALSPPPSQQGSPREGERRVGTA
SVLQPVKKRKVDMPITVSYAISGQPVATVLAIPQGQQQSYVSLRPDLLTVDSAHLYSATG
TITSPTGETWTIPVYSAQPRGDPQQQSITHIAIPQEAYNAVHVSGSPTALAAVKLEDDKE
KMVGTTSVVKNSHEEVVQTLANSLFPAQFMNGNIHIPVAVQAVAGTYQNTAQTVHIWDPQ
QQPQQQTAQEQTPPQPQQQQQLQVTCSAQTVQVAEVEPQSQPQPSPELLLPNSLKPEEGL
EVWKNWAQTKNAELEKDAQNRLAPIGRRQLLRFQEDLISSAVAELNYGLCLMTREARNGE
GEPYDPDVLYYIFLCIQKYLFENGRVDDIFSDLYYVRFTEWLHEVLKDVQPRVTPLGYVL
PSHVTEEMLWECKQLGAHSPSTLLTTLMFFNTKYFLLKTVDQHMKLAFSKVLRQTKKSPS
NPKDKSTSIRYLKALGIHQTGQKAPRV
NT seq 2064 nt   +upstreamnt  +downstreamnt
atgaataattctctagagaacaccatctcatttgaagagtacatccgagtaaaggcgagg
tctgtcccgcaacacaggatgaaggaatttctggactcgctggcttctaagggaccagaa
gctcttcaggagttccagcagtctgccaccaccaccatggtgtaccagcagggtgggaac
tgcatttatacagacagcactgaagtggctgggtctttgcttgaacttgcttgtccagtc
acaaccagtgttcaaccacaaactcagcaagagcagcagatccaggttcagcagccacag
caggttcaggtacaggtgcaggtacagcagtctccacagcaggtctcagctcagcagctt
tccccgcagttcaccgttcaccagcctgctgagcaacccatccaggtccaggtgcagatc
cagggccaagcaccacagtccgcagccccctccatccagactccatcactgcagagcccc
agcccctcgcagctgcaagcagcccagatccaggtgcagcacgtgcaggcagcgcagcag
atccaggctgcagaaatcccagaggagcatatcccacatcaacagatccaagctcagttg
gtggcaggccaatctcttgctgggggccagcagattcaaattcagaccgtgggcgctctt
tccccaccaccctcccagcagggctcacccagggaaggggagcggagggttggcacagcc
agtgtccttcaaccagtgaagaaacgcaaagtggacatgcccatcaccgtgtcctatgcc
atctcagggcagccagtggccaccgtgctggccattccacaaggccagcaacagagttac
gtgtctttgaggccagacttactgacagtagacagtgcccacctgtacagcgccactggg
accataactagccctacaggagaaacttggaccatccctgtttattccgcccagccccgg
ggggaccctcagcagcagagcattacccacattgccattccccaggaagcctacaatgca
gttcacgtcagtggctcacccacggctctggcagctgtaaagctggaggatgacaaggag
aagatggtgggcaccacatccgtagtgaagaactcccatgaagaggtagtgcagaccctt
gcaaactctctctttccagcacagttcatgaatggcaacatccacattccagtggctgtg
caggctgtagcaggcacgtaccagaatacggctcagactgtacatatatgggacccacag
cagcagccgcaacagcaaactgcacaagaacagacaccaccacagccacagcaacagcag
cagctgcaggtcacttgttcagcacaaactgttcaggtcgctgaagttgagccacagtca
caaccgcagccttcaccagagcttttgcttccaaattcactgaagccagaagaagggcta
gaagtatggaaaaactgggctcagaccaagaatgctgaactagaaaaggatgctcaaaac
agattggcccccattgggaggcgccagttgctacgattccaagaagatctgatctcatct
gctgtggctgaattgaattatggcctttgtttaatgacacgagaagctcggaatggagaa
ggtgaaccctatgacccagatgtactctactacattttcttgtgtatacagaagtatctt
tttgaaaatggaagagtagatgacatattctctgatctttactatgttcgttttaccgaa
tggctacatgaagttctgaaggacgtgcagccccgggtcactccacttggctatgttctg
cccagccacgtgactgaagagatgctgtgggaatgcaagcagcttggggcacattcccct
tcgacactgctgaccaccctcatgttcttcaacaccaagtactttctgttgaagacagta
gatcagcacatgaagctggcgttctccaaggtcctccggcagacaaagaagagcccctcg
aatcctaaggataaaagcactagtatccgctacctgaaggccctcggaatacatcagact
ggccagaaagcccccagagtgtga

DBGET integrated database retrieval system