KEGG   Rattus norvegicus (rat): 301011
Entry
301011            CDS       T01003                                 
Symbol
Uqcrc1
Name
(RefSeq) cytochrome b-c1 complex subunit 1, mitochondrial precursor
  KO
K00414  ubiquinol-cytochrome c reductase core subunit 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04260  Cardiac muscle contraction
rno04714  Thermogenesis
rno04932  Non-alcoholic fatty liver disease
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05208  Chemical carcinogenesis - reactive oxygen species
rno05415  Diabetic cardiomyopathy
Module
rno_M00152  Cytochrome bc1 complex
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    301011 (Uqcrc1)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    301011 (Uqcrc1)
  09159 Environmental adaptation
   04714 Thermogenesis
    301011 (Uqcrc1)
 09160 Human Diseases
  09161 Cancer: overview
   05208 Chemical carcinogenesis - reactive oxygen species
    301011 (Uqcrc1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    301011 (Uqcrc1)
   05012 Parkinson disease
    301011 (Uqcrc1)
   05014 Amyotrophic lateral sclerosis
    301011 (Uqcrc1)
   05016 Huntington disease
    301011 (Uqcrc1)
   05020 Prion disease
    301011 (Uqcrc1)
   05022 Pathways of neurodegeneration - multiple diseases
    301011 (Uqcrc1)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    301011 (Uqcrc1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    301011 (Uqcrc1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    301011 (Uqcrc1)
Peptidases and inhibitors [BR:rno01002]
 Metallo peptidases
  Family M16: pitrilysin family
   301011 (Uqcrc1)
SSDB
Motif
Pfam: Peptidase_M16 Peptidase_M16_C M16C_assoc
Other DBs
NCBI-GeneID: 301011
NCBI-ProteinID: NP_001004250
RGD: 1303314
Ensembl: ENSRNOG00000032134
UniProt: Q68FY0
Position
8:109589735..109601481
AA seq 480 aa
MAASAVCRAACSGTQALLRTCRSPALLRLPALRGTATFVQALQSVPETQVSVLDNGLRVA
SEQSSHPTCTVGVWIDVGSRYETEKNNGAGYFLEHLAFKGTKNRPGNALEKEVESIGAHL
NAYSTREHTAYLIKALSKDLPKVVELLADIVQNISLEDSQIEKERDVILREMQENDASMQ
NVVFDYLHATAFQGTPLAQAVEGPSENVRRLSRTDLTDYLSRHYKAPRMVLAAAGGVKHQ
QLLDLAQDHFSSVSQVYEEDAVPSITPCRFTGSEIRHRDDALPLAHVAIAVEGPGWANPD
NVALQVANAIIGHYDCTYGGGVHLSSPLASVAVANKLCQSFQTFNISYSETGLLGAHFVC
DAMSIDDMIFFLQGQWMRLCTSATESEVTRGKNILRNALISHLDGTTPVCEDIGRSLLTY
GRRIPLAEWESRIEEVDAQMVREVCSKYFYDQCPAVAGYGPIEQLSDYNRIRSGMFWLRF
NT seq 1443 nt   +upstreamnt  +downstreamnt
atggcggcgtccgcagtctgccgagcggcctgctctgggacgcaagcgctacttcgcacc
tgccgctcgccggccctgctgaggctacctgccttgcggggtaccgcaaccttcgtccag
gccctccagagcgtgccggagacacaggtcagcgtattggacaacgggctgcgtgtggcc
tcggagcagtcctcgcatcctacctgcacggtgggagtgtggattgacgttggcagtcgc
tatgagactgagaagaacaatggagcaggctactttttggaacatctggctttcaaggga
acaaagaaccgtcctggcaatgccttagagaaggaggtagagagtattggcgcccatctt
aatgcctacagcactcgggagcacactgcttacctcatcaaggcactgtccaaggacctg
ccaaaagttgtggagctcctggcagatattgtgcagaacattagtctggaagactcgcag
atcgagaaggagcgagatgtgatcctgcgggagatgcaggaaaacgatgcctctatgcag
aatgtagtcttcgattacctgcatgcaacagcattccagggcacacctctagcccaggct
gtggaggggcccagtgagaacgtcaggaggctgtcgcgcacagacttgactgactacctc
agcaggcactacaaagctccccgaatggtgctggctgccgctggaggggtgaagcaccag
cagctgctagaccttgcccaggatcacttcagcagtgtctcccaggtgtatgaagaagac
gctgtacctagtataactccatgtcgcttcactggcagtgagatccgacatcgggatgat
gccctgcccttggcccatgtggccattgcagtagagggacctggctgggctaacccagac
aacgtggctctccaagtggccaatgccatcataggccactatgactgcacttacggtggt
ggagtgcacctgtccagcccgctggcttccgttgctgtagctaacaagctttgccagagt
ttccagaccttcaacatctcctactctgagaccgggttgctgggcgcacactttgtctgt
gatgccatgagcatcgatgacatgatcttcttcctgcaaggccagtggatgcgcctgtgc
accagcgctacagagagtgaggtgactcggggcaaaaacatccttaggaatgccttgata
tctcatttggatggcaccacccctgtgtgtgaagacattggtcgcagcctcctgacttat
ggccgccgcatccctctggctgagtgggagagccggattgaggaggtggatgcccagatg
gttcgagaggtttgctccaagtacttttatgaccaatgtccagcagtggctggatatggc
cccatcgaacagctctcagactacaaccggattcgcagtggcatgttctggctgcgcttc
tag

DBGET integrated database retrieval system