KEGG   Rattus norvegicus (rat): 301059Help
Entry
301059            CDS       T01003                                 

Gene name
Myd88
Definition
(RefSeq) myeloid differentiation primary response 88
  KO
K04729  myeloid differentiation primary response protein MyD88
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04064  NF-kappa B signaling pathway
rno04620  Toll-like receptor signaling pathway
rno04621  NOD-like receptor signaling pathway
rno05132  Salmonella infection
rno05133  Pertussis
rno05134  Legionellosis
rno05140  Leishmaniasis
rno05142  Chagas disease (American trypanosomiasis)
rno05143  African trypanosomiasis
rno05144  Malaria
rno05145  Toxoplasmosis
rno05152  Tuberculosis
rno05161  Hepatitis B
rno05162  Measles
rno05164  Influenza A
rno05168  Herpes simplex infection
Module
rno_M00686  Toll-like receptor signaling
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    301059 (Myd88)
   04064 NF-kappa B signaling pathway
    301059 (Myd88)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    301059 (Myd88)
   04621 NOD-like receptor signaling pathway
    301059 (Myd88)
 09160 Human Diseases
  09167 Infectious diseases
   05132 Salmonella infection
    301059 (Myd88)
   05133 Pertussis
    301059 (Myd88)
   05134 Legionellosis
    301059 (Myd88)
   05152 Tuberculosis
    301059 (Myd88)
   05162 Measles
    301059 (Myd88)
   05164 Influenza A
    301059 (Myd88)
   05161 Hepatitis B
    301059 (Myd88)
   05168 Herpes simplex infection
    301059 (Myd88)
   05144 Malaria
    301059 (Myd88)
   05145 Toxoplasmosis
    301059 (Myd88)
   05140 Leishmaniasis
    301059 (Myd88)
   05142 Chagas disease (American trypanosomiasis)
    301059 (Myd88)
   05143 African trypanosomiasis
    301059 (Myd88)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TIR Death TIR_2
Motif
Other DBs
NCBI-GeneID: 301059
NCBI-ProteinID: NP_937763
RGD: 735043
Ensembl: ENSRNOG00000013634
UniProt: Q6Y1S1
Position
8q32
AA seq 296 aa AA seqDB search
MSAGGPRVGSVSVDSYLFSLPLVALNVGVRRRLSLFLNPRTTAAADWTSLAEEMGFEYLE
IREFETRPDPTRSLLDAWQGRSGSSVGRLLELLALLDREDILYELKDRIEEDCQKYIRNQ
QKQESEKPLQVARVESSVPQTKELGGITTLDDPLGQTPELFDAFICYCPNDIEFVQEMIR
QLEQTDYRLKLCVSDRDVLPGTCVWSIASELIEKRCRRMVVVVSDDYLQSKECDFQTKFA
LSLSPGVQQKRLIPIKYKAMKKDFPSILRFITICDYTNPCTKSWFWTRLAKALSLP
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcgggaggcccccgcgtgggatccgtgtccgtggactcctacttgttctctcta
ccgttggtcgcgctcaacgtgggagtgaggcgccgcctctcgctgttcttgaacccgcgg
acaaccgcggcggccgactggacctcgctggcggaggagatgggtttcgagtacttggag
atccgcgagtttgagacgcgccccgatcccactcgcagtttgttggatgcctggcagggg
cgctctggctcgtcggtcggcaggctgctagagttgctagccttgttagaccgtgaggat
atactgtatgaactgaaggaccgcatcgaggaggactgccagaaatacatacgcaaccag
cagaaacaggagtctgagaagcccttgcaggtggccagagtggagagcagtgtcccacag
acaaaggaactgggaggcatcaccaccctcgatgaccccctggggcaaacgccggagctt
ttcgacgccttcatctgctactgccccaatgatattgagtttgtgcaggagatgatccgg
caactagaacagacagactatcggcttaaattgtgtgtgtccgaccgcgatgtcctgcct
ggcacctgcgtgtggtccatcgccagcgagctcattgagaaaaggtgtcgtcgcatggtg
gtggttgtttctgacgattacctgcaaagtaaggaatgtgacttccagaccaagtttgct
ctcagcctgtctccaggtgtccaacagaagcgactgatccctatcaagtacaaagcaatg
aagaaggactttcctagtatcctacggttcatcactatctgcgactataccaacccttgc
accaagtcctggttctggacccgtcttgccaaggctctgtccctgccctga

DBGET integrated database retrieval system