KEGG   Rattus norvegicus (rat): 301067
Entry
301067            CDS       T01003                                 

Gene name
Slc25a38, RGD1311914
Definition
(RefSeq) solute carrier family 25, member 38
  KO
K15118  solute carrier family 25, member 38
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    301067 (Slc25a38)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   301067 (Slc25a38)
SSDB
Motif
Pfam: Mito_carr
Other DBs
NCBI-GeneID: 301067
NCBI-ProteinID: NP_001025203
RGD: 1311914
Ensembl: ENSRNOG00000018552
UniProt: Q499U1
Position
8q32
AA seq 326 aa
MGVSAEPRSLSVARAGLASPVIEKARSALLPSQDVEDTVETLMLHPVIKAFLCGSISGTC
STLLFQPLDLLKTRLQTLQPSDVGPRRVGMLSVFLKVVRTETLLGLWKGMSPSIVRCVPG
VGIYFGTLYSSKQYFLRGHPPTALESVILGMGSRSVAGVCMSPITVVKTRYESGAYSYES
VYAALRSIYCSEGSRGLFRGLTATLLRDAPFSGLYLMFYSQTRATVLHGADELDAALMPL
VNFSCGVFAGILASLVTQPADVIKTHMQLSTVKCQCIGQVATLILKTHGLRGFFHGSVPR
ALRRTLMAAMAWTVYEEMMAKMGLKS
NT seq 981 nt   +upstreamnt  +downstreamnt
atgggcgtgagcgcggagcctcggagcctctcagtcgcccgggccgggctcgcgtccccc
gtgatcgagaaggcgcgctcggcgctgctgccgtcgcaggatgtagaggacacagtggag
acgctcatgttacatccagtgattaaggctttcctctgcggctccatcagcggaacctgt
tccacgctcctcttccagcctctggacctcctcaaaacccgcctgcagaccctgcagccc
tcagacgtagggcccaggcgtgttgggatgctgtctgtgttcttgaaggtggttcgcaca
gaaactcttctgggcctttggaaagggatgtctccttccattgtgagatgtgtccctggc
gttggaatctactttggcaccctgtattcttctaagcagtatttcttgcgaggccatcct
cccactgccctggaatcggtcatcctgggcatgggatctcgctctgtggcaggagtttgc
atgtcacccatcacagtggtcaagacacgctatgagagtggggcttacagctacgagagc
gtctatgcagccctgcggagcatctactgtagcgagggcagccgtggcctcttcaggggc
ctgacagcaactctgcttcgtgacgcccccttctcggggctctacctgatgttttacagc
cagaccagggccacagtgctccatggcgcagacgagctggatgctgctctgatgcccctt
gttaatttcagctgtggggtatttgctggcattctggcttcactggtgactcaacctgca
gacgtaatcaaaacccatatgcagctctccacagtgaagtgtcagtgcattggccaagtg
gccaccctcattctcaagacccatgggctgcgtggcttctttcatggcagtgttccccgg
gccctccgtagaactctgatggctgctatggcatggactgtctatgaagagatgatggcc
aagatgggcctcaagtcctga

DBGET integrated database retrieval system