KEGG   Rattus norvegicus (rat): 301068
Entry
301068            CDS       T01003                                 

Gene name
Eif1b
Definition
(RefSeq) eukaryotic translation initiation factor 1b
  KO
K03113  translation initiation factor 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03013  RNA transport
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    301068 (Eif1b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:rno03012]
    301068 (Eif1b)
Translation factors [BR:rno03012]
 Eukaryotic type
  Initiation factors
   eIF-1
    301068 (Eif1b)
SSDB
Motif
Pfam: SUI1
Other DBs
NCBI-GeneID: 301068
NCBI-ProteinID: NP_001100337
RGD: 1309241
Ensembl: ENSRNOG00000018848
UniProt: B5DFN1
Position
8
AA seq 113 aa
MSTIQNLQSFDPFADATKGDDLLPAGTEDYIHIRIQQRNGRKTLTTVQGIADDYDKKKLV
KAFKKKFACNGTVIEHPEYGEVIQLQGDQRKNICQFLLEVGIVKEEQLKVHGF
NT seq 342 nt   +upstreamnt  +downstreamnt
atgtccactatccagaacctccaatctttcgacccctttgctgatgcaactaagggcgac
gacttactcccggcagggactgaggactacattcatataagaatccagcagcggaacggc
aggaagacgctgaccactgtgcagggcattgcggacgattatgacaaaaagaaacttgtg
aaagctttcaaaaagaaattcgcctgtaatgggactgtgattgaacaccctgagtacgga
gaggtcattcagcttcaaggcgaccaaaggaagaacatttgccagtttcttttggaggtt
ggcatcgtcaaggaggagcagctgaaggttcacggattctaa

DBGET integrated database retrieval system