KEGG   Rattus norvegicus (rat): 301085Help
Entry
301085            CDS       T01003                                 

Gene name
Fyco1
Definition
(RefSeq) FYVE and coiled-coil domain containing 1
  KO
K21954  FYVE and coiled-coil domain-containing protein 1
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    301085 (Fyco1)
Membrane trafficking [BR:rno04131]
 Endosome - Lysosome transport
  Rab GTPases and associated proteins
   Rab associated proteins
    301085 (Fyco1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FYVE RUN GOLD_2
Motif
Other DBs
NCBI-GeneID: 301085
NCBI-ProteinID: NP_001100340
RGD: 1309069
Ensembl: ENSRNOG00000006336
UniProt: D3Z9D2
Position
8q32
AA seq 1451 aa AA seqDB search
MASSSTETQLQRIIRDLQDAVTELSNEFKEGGEPITDDSTSLHKFSYKLEYLLQFDQKEK
ASLLGSKKDYWDYFCACLAKVKGANDGIRFVRSISELRTSLGKGRAFIRYSLVHQRLADT
LQQCFMNTKVTSDWYYARSPFLKPKLSSDIVGQLYELTEVQFDLASRGYDLDAAWPTFAR
RTLATSSSYMWKPPSRSSSMSSLVSNYLQTQEMASSLDLNSSLNNEALESFDEMRLELDQ
LEVREKQLQEHVQQLNRENQALRMTISKQGGQLQVEKETGYLAVEDSIDLVSLVAELQKQ
GEVTQATVKKLQTCLQALELAVDQKETSHSVLQLENVAQALDAVRDSLGRKNQLLASLSE
CLTRAEKREHPSLDTKLHQEPVPTDLALKFQELKGKLQTLEGENTKAQELNRQQSLKLEQ
LAKELQLKEEARASLEHLVKDAVPLQEELSGKKQESAQLRRQLQESLAHLSSVEEELAEA
RQQEKQHREEKQLLEQEAKSLTWQLQLLETQLGQVSQLVSDLEEQKKQLMQDKDHLSQKV
GTLEQLAEAHGASKSKEAVPPQAGEMPEKGQHCLQEEQVNNATVRGADQDELQKVNQELQ
KELQNMAVRNQLLEGKLQALQTDYKALQQREAAIQGSLASLEAEQASIRQLGNQMEASLL
AVRKAKETMKAQVAEKEAALQSKEGECRQLQEEAEQCRLRTEAQAQELRALENQCQQQIQ
LIEVLSAEKGQQGLSLPQVNTAQLALSQAQLEIHQGEAQRLQNEVVDLQAKLQVALGDRD
KLQSQLGVAEAVLGEHKTLVQQLKEQNEALNRAHIQELLQCSEREGILQEESIYKAQKQE
QELRALQAELSQVRCSSEGAHLEHAELQDQLHRANTDTAELGIQVCALTAEKDRMEGALA
SLAQELQDSKEAALQERKGLELQVMQLQQEKESLQEKLKATEEAASSFSVLQAQLAQAEQ
LAQSLQEAAHQEQDALKFQLSAEIMDHQNRLKTANEECGSLRAQLEEQGQELQMTKEAVQ
ELKITKATMEEKLNCTGSHLAECQATLLRKDEESAMLRINLERTQKELEKATSKFQEYYN
KLCQEVTNRERNDQKMLADLDDLNRTKKYLEERLIELLRDKDALWQKSDALEFQQKLSAE
EKCLGDMEANHCHDCKREFSWIVRRHHCRLCGRIFCYYCCNNYVVTKPSGKKERCCRACF
QKFGESSGSPDSSGSGTSQGEPSPMVSPAEAAPQSIGSQGINPVCRPPDDAVFDIITDEE
LCQIQESGSSLPETPTETDSMDPNMAEQDTTSNSLTPEDTEDMPLGQDAEICLLKSGELM
IKLPLTVEEIASFGEGNRELFVRSSTYSLIPITVAEPGLTISWVFSSDPKSISFSVVFQE
TEDTPLDQCKVLIPTTRCNSHKESIRGQLKVRTPGIYLLIFDNTFSRFISKKVFYHLTVD
RPVIYDGSDFP
NT seq 4356 nt NT seq  +upstreamnt  +downstreamnt
atggcttctagcagcactgagacgcagctccagaggatcatccgtgatctacaagatgca
gtgacagaactaagcaatgaatttaaggaaggcggagaaccaatcacagatgacagcacc
agcttgcacaagttttcttacaaacttgagtatcttctgcaatttgatcagaaggagaag
gctagcctcctgggtagcaagaaggactactgggattacttctgtgcgtgcctagccaag
gtgaaaggagccaatgatgggattcgattcgtcaggtccatctctgagctccgaacatct
ctaggaaaggggagagccttcattcgctactctttggtgcaccagaggttggcagacacc
ttgcagcagtgcttcatgaacaccaaagtgaccagtgactggtattatgcaagaagcccc
tttctgaagccaaagctgagctctgacattgtgggccagctgtatgagctgactgaggtt
cagtttgatctagcatcaagaggctacgacttggatgccgcctggccaacatttgccagg
aggacgctagccaccagctcttcttacatgtggaaaccccccagccgaagctccagcatg
agtagtttagtgagcaactacttgcagactcaggagatggcctccagtcttgacctgaat
agttctctaaacaatgaagcactagaaagcttcgatgagatgcggctggagctggaccag
ttggaggttcgggagaaacagctacaagagcacgtgcagcagctaaacagggaaaaccaa
gcacttcgaatgacgatcagcaagcaaggggggcaacttcaggtagagaaggaaacgggg
taccttgcagtcgaggatagcattgacctcgtgagcctggtggcagagctccagaagcag
ggggaggtcacccaggccacagtgaagaagctacagacatgtctacaggctctggagtta
gctgtagaccagaaagagaccagccactcagtcttgcagcttgagaacgtggcacaggca
cttgacgctgtgagagactccttgggtaggaagaaccagcttctagccagcctttctgaa
tgcctcactagggctgaaaaaagggaacatccatctctggacacaaagcttcatcaagag
ccagttcctactgacctggccctgaagttccaggagctgaagggaaaacttcaaacccta
gaaggagagaacaccaaggcccaggagctaaacaggcagcaaagtctcaagctagagcag
ctggccaaggagctgcagctgaaggaggaagcccgagctagcctggaacacttagtgaag
gatgcggtcccacttcaggaagagctatccggaaagaagcaagagtcagctcagctccga
cgacagcttcaggaatccctggcccacttgagctctgtggaggaggagctggctgaagcc
agacagcaggaaaagcagcatcgagaagaaaaacagctactagagcaggaggccaagtct
ctgacatggcagctgcagctcctagagacccaactaggacaggtgagtcagcttgtgagt
gacctggaggagcagaagaagcaactcatgcaggacaaagaccatctcagccagaaagta
ggaacactagagcagctagctgaggcccatggggcaagtaagagtaaagaggctgtccca
ccacaggctggggagatgccagaaaaggggcagcactgcctccaggaagaacaggtaaac
aatgccacagtgcgaggggcagaccaggacgagttacaaaaggtcaaccaggagctacag
aaggagctgcagaacatggctgtgcgcaaccagctcctagaaggcaaactgcaggccttg
caaactgattacaaggcactgcagcagcgagaggcagcaatccagggctctttagcctcc
ctggaagctgagcaggccagcatccggcagctgggaaaccagatggaagcaagcctcctg
gctgtgaggaaagccaaagagactatgaaggcccaggtggcagagaaggaggctgccctg
cagagtaaggagggcgagtgccggcagctgcaggaagaggcagagcagtgccggcttcgg
acagaggcccaggcccaggagctcagagctcttgagaaccagtgccagcagcagattcaa
ctgattgaggtcctctctgcagaaaaaggccaacagggactcagcctaccccaggtcaac
acagcccaactggccctgtctcaagcacagcttgaaattcaccagggggaagcccagcgg
ttacagaatgaggtggtggacctccaggccaagctccaggtggccctaggtgatcgagac
aagttacagagccaactgggtgtggctgaggcagttctcggggagcacaagaccctggtg
caacaactgaaagaacagaatgaagccctcaacagggcccatattcaggagctgctgcag
tgctcagagagagaggggatactgcaggaggagagcatctacaaggcccagaagcaggag
caagagctacgagccctgcaggcagagctgtcacaggtgaggtgcagctctgagggagcc
cacctggagcatgcagagctacaggaccagctgcaccgagccaacacagacacagctgag
ctaggcatacaggtctgtgcactgacagctgagaaggatcggatggagggggccctggcc
agcctagcccaggagctccaggactccaaagaagcagcactacaggaacgaaagggctta
gagctccaagtgatgcaacttcagcaagagaaggagagcttgcaggaaaagctgaaggca
actgaggaggcagccagttcattctctgttcttcaggcacagctggcccaggctgagcag
ctggcccagagcctccaagaggctgcacaccaggaacaagatgcccttaagttccagcta
agtgctgagattatggaccaccagaacagactaaagacagccaatgaagagtgtgggagc
ctcagggcccagctagaagaacaaggccaggagctgcaaatgactaaggaggctgtgcag
gaactgaagatcaccaaggcgaccatggaggagaagctgaattgcaccggtagccacctt
gcagagtgccaggccactttgctacgcaaagatgaagaaagcgctatgcttcgaatcaac
ctagagagaacacagaaggaacttgaaaaggctacatcaaaattccaagaatattacaac
aaactctgccaggaggtgacaaacagggaaaggaatgaccagaagatgcttgcagaccta
gatgacctgaacagaaccaagaaataccttgaggagcggctgatagagctgctcagggac
aaagatgctctctggcaaaagtccgatgcactggaattccagcagaagctcagtgctgaa
gagaaatgtcttggggacatggaggccaaccactgccatgactgcaagcgggagttcagc
tggatagtgcggcggcaccactgcaggttatgtggccgaatattctgttactactgctgt
aacaactatgttgtgactaagcccagtggcaagaaggaacggtgctgccgagcctgcttc
cagaagtttggtgaaagctctggatcccctgacagcagtggttcgggcactagccaggga
gagcccagccccatggtgtcaccagctgaagcagctccccagtccataggaagccaagga
ataaacccagtctgcagaccaccagatgatgctgtgtttgacatcatcaccgatgaggaa
ctgtgccagatccaagaatctggctcctccttgcctgaaacacccaccgaaactgattcg
atggacccaaatatggctgaacaggacaccacatcaaactcattaacccctgaagacact
gaagacatgcccctggggcaggatgctgaaatctgcttgctgaagtcaggagagctgatg
atcaaattacccctcacagtagaggagatcgccagctttggggagggaaacagggagctg
tttgtgaggtccagtacctacagcctgatccccatcaccgtggctgagcccggccttacc
atcagctgggtcttctcttctgatcccaagagcatctccttcagtgtggtcttccaagag
acagaagacacgccactcgaccagtgcaaggtcctcattcccaccacacgctgcaattcc
cacaaggagagcatccggggccagctgaaggtccgaacccctggcatctacttgctcatc
tttgacaacaccttttccagatttatctccaaaaaagtattttaccacctgaccgttgac
cggcctgtgatctacgatggaagtgatttcccatag

DBGET integrated database retrieval system