KEGG   Rattus norvegicus (rat): 301097Help
Entry
301097            CDS       T01003                                 

Gene name
Vwa5a, Loh11cr2a, masa-1
Definition
(RefSeq) von Willebrand factor A domain containing 5A
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: VIT VWA_3 VIT_2 VWA_2 VWA
Motif
Other DBs
NCBI-GeneID: 301097
NCBI-ProteinID: NP_942050
RGD: 735145
Ensembl: ENSRNOG00000000195
UniProt: Q75WE7
Position
8q22
AA seq 822 aa AA seqDB search
MEHHWGLITGNKEKVPLKSISVTLSINDFVAAVAATLHYENEEKVPIEAMFVFPMDEDSA
VYSFEALVDGKKIVAELQDKTKAHSKYEEALSQGHQAYLLEEDDYSRDVFSCNVGNLQPG
TKVAVTLRYVQELPLESDGALRYLLPAVLNPRYQLSEQSASSCLNVQKPIVPLEALPYTL
SMVATITSQHGIERVQSNCSLSPIQYLTDDKTSAQVSLTEGHKFDRDVELLIYYREVHSP
SVAVEKGMQDKKRDSLMGAPCAMVSFYPDIPEVNASKVCGEFVFLMDRSGSMQTPMRTEE
NSQLRIEAAKETLLLLLKSLPMGCYFNIYGFGSSYEQFFPESVKYTQETIEEAVERVKRL
DADLGGTEILTPLRNIYKTSSIPGHPLQLFVFTDGEVSDTYSVIREVKLNSKKHRCFSFG
IGQGASTSLIKNIARVSGGTAEFITGKDRMQAKALGSLKLALQCALDDISLSWELPPGLS
VNMLSPEQPTIFRGQRLIIYAQLTGPMPQAESRGAVCLKHTLQGKSLENKVAFSLQPKEN
ANFTIHRLAAKFLIQTKDLGSHEVSKEEKKDVMNISLQSGVLSSFTAFVAINKELNKPVQ
GPLAHRVIPRPMIATSTSMFMRSCSRLTGPFKNSRLKRRLCAADYVPYGHESTVYSSMPS
PAPIENQGVADSSNEKSNSQNEHKAFGENVVLQLIFLQNANGSWKLDENLTKILGTTLED
TKAANPSQHGDPSAWATILAVLWLHANGQDLKCEWELLERKAVAWLHDHAGRGTTPPPFP
SFHLHPREPCLYVLQRTQESLWLSQLCCLRTLSLQLILHFQD
NT seq 2469 nt NT seq  +upstreamnt  +downstreamnt
atggagcatcactggggcctaatcactggcaacaaggagaaagtaccactgaagagcatc
tcagtcaccttgtccatcaatgactttgtggctgctgtggctgcaaccctacattatgag
aatgaggagaaagtcccaatagaggcaatgtttgtgtttcctatggatgaagactctgct
gtctacagctttgaagccttggtggatgggaagaaaatcgtggcagagttgcaggataag
acgaaggcgcacagcaagtatgaggaggcactctcccagggccaccaagcatacttattg
gaagaggatgattattccagggatgtcttttcttgcaatgtggggaacctgcagcctgga
actaaggttgcagttaccttgaggtatgtgcaggaactgccattggaatcagatggggcc
ctgcgctacctgctcccagcagtcttgaatccaagatatcagctttctgaacagtcagcg
agcagttgcttgaatgtacagaagcccattgtccctttggaggccctgccttacacactc
agcatggttgccaccatcacttcccagcatggtattgagagggtccaatccaactgctcc
ttgagccctattcagtaccttacagatgacaagacttctgctcaggtttccttgactgaa
gggcataagtttgaccgggatgtggaactcctgatttactaccgtgaagtgcacagcccc
agtgtagctgtggagaagggaatgcaggacaagaagcgagatagtttgatgggagctcct
tgtgcaatggtgagcttctacccagacatcccagaagtgaacgcctcaaaggtctgtgga
gaatttgtgtttctaatggaccgctcaggaagtatgcaaacccccatgagaacagaggaa
aattctcagctacgcatagaggctgccaaggaaactctgctgttgttgctgaagagtttg
cctatgggttgttattttaacatctatggatttggatcttcctatgaacaattcttcccg
gagagtgtgaagtacactcaggaaacaattgaggaagcagtggaacgagtgaagcgttta
gatgccgatttagggggtactgaaatcttgacacccctccgcaacatttacaagacatcc
tccattcctggacatcccctacagctctttgtcttcacagacggagaagtgagtgacaca
tatagtgtcatcagagaagttaagttaaacagcaagaaacacagatgtttctcatttggt
attggacaaggagcctccaccagcttaatcaaaaacatcgcccgggtatcagggggcact
gcagagtttatcacaggcaaggacaggatgcaggctaaggctcttgggtctctcaagctt
gcgctacagtgtgcattggatgatatctccctgagttgggaattgcctcctggtctgtct
gttaacatgctctctccagagcagcctaccatctttaggggtcagaggttaatcatctat
gcccaactgactgggcctatgcctcaagcggagagcagaggagcagtgtgcctcaagcac
accctccagggcaagagtctggaaaacaaggtggcattttccctacaacccaaggaaaat
gccaattttaccattcatcggttggcggcaaagttcttgattcagaccaaggatttggga
tcccatgaagtctcaaaagaagagaaaaaggatgtgatgaacatcagccttcagtctgga
gttctcagctccttcacagcctttgttgccataaacaaagagcttaacaagccagtgcag
ggccctctggcccacagagtcattcctaggccaatgatagctacatctacatctatgttt
atgaggtcatgcagtcgtctcacaggtccctttaaaaactcacgcctaaaacgtagatta
tgtgcagcagactatgttccatatggacatgaaagcactgtgtattctagcatgccaagt
ccagcacccatagaaaatcagggagtggcagattcttcgaacgagaaaagcaactcgcaa
aatgaacacaaagcatttggggagaatgttgtgttgcagctgatttttctgcaaaatgca
aatggctcctggaagctggatgaaaatctgaccaagatcctgggcactacattggaagac
accaaggctgccaacccttctcagcatggggacccctcagcctgggccacaatcctggct
gtgctctggctccatgccaatggccaggacttaaagtgtgagtgggagcttctggaacgg
aaggctgtggcctggcttcatgatcatgcaggtaggggcacaacccctccgccctttcct
tctttccatttgcatcccagggagccatgcctctatgtgttgcagcgcactcaagagtcc
ctatggctgtcccaactatgctgtctcagaacattgtccctccagctaatccttcatttt
caggattag

DBGET integrated database retrieval system