KEGG   Rattus norvegicus (rat): 301111Help
Entry
301111            CDS       T01003                                 

Gene name
Ano10, RGD1308260, Tmem16k
Definition
(RefSeq) anoctamin 10
  KO
K19327  anoctamin-10
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    301111 (Ano10)
Ion channels [BR:rno04040]
 Chloride channels
  Chloride channel, calcium-activated (CaCC)
   301111 (Ano10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Anoctamin DUF898 DUF4795
Motif
Other DBs
NCBI-GeneID: 301111
NCBI-ProteinID: XP_001078269
RGD: 1308260
Ensembl: ENSRNOG00000000219
UniProt: D3ZF54
Position
8q32
AA seq 688 aa AA seqDB search
MKGILSTVDTCESSFTPLVVIELAQDVKEETKEWLKSRIISPKKDGGAQLLFRPLLNKYE
KETLENQNLYLVGASNIRLLLGAEAVGLVKECTDGAMRAFTYRTRHNFKGFHGNNDDFLT
MAECQFIIKHELENLRARDEKMIPGYPQAKLYPGKSLMRRLLTSGIVTQVFPLHDTEALK
KLEDTWYTRFALKYQPIDSIRGYFGETIALYFGFLEYFTFALIPMAVIGLPYYLFVWEDY
DKYVIFASFNLIWSTVILEVWKRGCANMTYRWGTLVMKRQFEEPRPGFHGVLGINSVTGR
EEPVYSSYKRQLRTYLVSLPFVCLCLYFSLYVMMIYFDMEDWALSLHEDSGSEWTSLLLY
VPSIVYAIVIEIMNRLYRYAAEFLTSWENHRLESAYQNHLVLKVLVFNFLNCFASLFYIA
FVLKDMKLLRQSLATLLITSQILNQVVESLLPYWLQRKYCARVKRKVRALKSDVDTTLYE
QVLLEKEMGTYLGTFDDYLELFLQFGYVSLFSCVYPLAAAFAVLNNFTEVNSDALKMCRV
FKRPFSEPSASIGVWQLAFETMSVISVVTNCALIGMSPQVNAVFPESKTDLVLIVVAVEH
ALLALKFILAFAIPDKPRHIQMKLARLEFESLEALKQQQMKLVAESLKEESQEEEKEAAA
CRMPATLPQPELRNNCITPGQGGDASLS
NT seq 2067 nt NT seq  +upstreamnt  +downstreamnt
atgaaagggattttatcaactgtggatacttgtgagagctccttcacacctctagtggtc
atagagctcgcccaggatgtcaaagaagaaaccaaagaatggctcaaaagcagaatcatt
tccccaaagaaagatggaggtgcccagctgttgtttagaccactgctaaataagtatgag
aaagaaactctagaaaaccagaatttataccttgttggtgcctcgaacatccgactgttg
ctgggggcagaagcagtaggcctggtgaaggaatgtacagatggcgccatgcgggccttc
acctacagaacccgccacaactttaaaggtttccacggtaacaatgatgacttcctcacc
atggctgagtgtcagttcattatcaaacacgaacttgagaatcttagagccagagacgag
aagatgatccccggctacccgcaggccaaattgtaccccgggaagtcactgatgaggaga
ttgctcacatctggcatcgtgacccaggtgtttccactgcatgacacggaggccctgaag
aagcttgaggacacctggtacactcggtttgctctgaagtatcagcccatagatagcatt
cgtggctacttcggggagacaatcgccctgtactttgggttcctggagtactttaccttt
gccttaattcccatggccgtcattgggctgccctactacctgttcgtgtgggaagactac
gacaagtatgtcatctttgcctcgttcaacctcatctggtccacagtgatcctggaggtg
tggaagcgtggctgtgccaacatgacctatcgctgggggacactggtcatgaagaggcag
tttgaggaaccccggccagggtttcatggagtccttggcatcaattcagtcactggcagg
gaggagcccgtctactccagctacaagaggcaactgcgtacctacctggtctctctgcca
tttgtgtgcctctgcctctacttctccctctatgtcatgatgatctactttgacatggag
gactgggccttgagtctccatgaggacagtgggtctgagtggaccagcctcctgctgtac
gtgcccagtattgtttatgccattgtgatcgagatcatgaaccgtctctatcgatatgct
gctgagttcctaacgtcttgggagaatcacagactggaatctgcctaccagaatcatctt
gttctgaaagtgttggtgttcaactttctgaattgcttcgcctcgctcttctacattgct
tttgtcctgaaggacatgaagcttctgcgccagagcttggccacactcctgatcacctcc
cagatcctgaaccaagttgtagaatctctccttccttactggctccagcggaagtactgt
gcgcgggtgaagaggaaagtgcgggcattgaagtcggatgttgacacgaccttgtatgag
caagtcctcctggagaaggaaatgggcacttacctggggacctttgatgattacttggag
ttgttcctgcaatttggctacgtgagccttttctcttgcgtttacccgttagcagctgct
tttgctgtgttaaacaacttcacggaagtcaactcagatgccttgaaaatgtgtagggtc
ttcaaacgaccgttctcagagccttcggccagtattggcgtgtggcagttggcttttgaa
acaatgagtgttatatctgtggtcactaactgtgctctgatcggaatgtcaccacaagtg
aatgcagtctttccagaatccaaaacagaccttgttctgatcgtggtggctgtggagcac
gcactcttggctttgaagttcatacttgcctttgccatccctgataaaccacgccacatc
cagatgaaactggccaggctggaattcgagtctttggaggcactcaagcagcagcaaatg
aagctggtggcagaaagcctgaaggaggagtcccaggaagaagagaaggaagccgccgca
tgccgcatgccggccaccctgccccagcctgagctgaggaacaactgcatcacacctgga
cagggaggggacgccagcctgagctga

DBGET integrated database retrieval system