KEGG   Rattus norvegicus (rat): 301118
Entry
301118            CDS       T01003                                 

Gene name
Acer1
Definition
(RefSeq) alkaline ceramidase 1
  KO
K01441  alkaline ceramidase [EC:3.5.1.23]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00600  Sphingolipid metabolism
rno01100  Metabolic pathways
rno04071  Sphingolipid signaling pathway
Module
rno_M00099  Sphingosine biosynthesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    301118 (Acer1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    301118 (Acer1)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.23  ceramidase
     301118 (Acer1)
SSDB
Motif
Pfam: Ceramidase CitMHS
Other DBs
NCBI-GeneID: 301118
NCBI-ProteinID: NP_001100345
RGD: 1588582
Ensembl: ENSRNOG00000047368
UniProt: M0R603
Position
9
AA seq 273 aa
MYAPSTRAKMSSIFAYQSSEVDWCESNFQHSELVAEFYNTFSNVFFLIFGPLMMFLMHPY
AQKRSWGIYGVSVLFMVIGLFSMYFHMTLSFVGQLLDEISILWLLASGYSVWLPRCYFPK
FIKGSRFYFSCLVIMTTIISTFLTFVKPTVNAYALNSIAIHILYIVRKEYKKTSNRDLRH
LIAVSVILWAAALTSWVSDRVLCSFWQRIQFFYLHSIWHVLISITFPYGIVTMALVDAKY
EMPDKTLKVHYWPRDSWLIGLPYVEIQENDKNC
NT seq 822 nt   +upstreamnt  +downstreamnt
atgtatgcaccgagcaccagagcaaagatgtccagcatctttgcctatcagagctctgag
gtggattggtgtgagagtaatttccagcactcggagttggtggccgagttctacaatacg
ttcagcaatgtgttcttcctcatctttggacccctcatgatgttccttatgcacccgtat
gcccagaagcgttcctggggtatctatggagtgtcagtcctcttcatggtcataggtctg
ttctccatgtatttccacatgacactcagcttcgtggggcagctgctggatgagatctcc
atcctgtggttgctggccagtggatacagcgtgtggttgccccgttgctacttccccaag
ttcatcaaggggagcaggttctacttcagctgcctggtaattatgaccaccattatcagc
accttcttgacgttcgtgaagcccacagtcaatgcctatgccctcaacagtatcgccata
cacatcctctacattgtacgcaaagagtacaagaagactagcaacagggatcttcggcat
ctgattgctgtttctgtgatcttgtgggccgccgccctgaccagctgggtcagcgaccgt
gtgctctgcagtttctggcagcggattcagttcttctacctgcatagcatttggcatgtc
ctcataagcatcactttcccttatggtattgtgaccatggccctggtggacgccaagtat
gagatgccagataaaaccctcaaagtccactactggccccgggacagctggctcattggg
ctgccctatgtggagatccaggagaatgacaagaactgctga

DBGET integrated database retrieval system