KEGG   Rattus norvegicus (rat): 301119Help
Entry
301119            CDS       T01003                                 

Gene name
Mllt1
Definition
(RefSeq) MLLT1, super elongation complex subunit
  KO
K15187  YEATS domain-containing protein 1/3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    301119 (Mllt1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:rno03021]
    301119 (Mllt1)
   03036 Chromosome and associated proteins [BR:rno03036]
    301119 (Mllt1)
Transcription machinery [BR:rno03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Super elongation complex (SEC)
     301119 (Mllt1)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Histone modification proteins
   HMT complexes
    Dot1-containing complex
     301119 (Mllt1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AHD YEATS BET
Motif
Other DBs
NCBI-GeneID: 301119
NCBI-ProteinID: NP_001100346
RGD: 1588581
Ensembl: ENSRNOG00000048736
UniProt: M0R462
Position
9q12
AA seq 547 aa AA seqDB search
MDNQCTVQVKLELGHRAQLRKKPTTEGFTHDWMVFVRGPEQCDIQHFVEKVIFRLHDSFP
KPKRVCKEPPYKVEESGYAGFIMLIEVYFKNKEEPRKVCFTYDLFLNLEGNPPVNHLRCE
KLTFNNPTTEFRCKLLMAGGVMVMPEGADTVSRPSPDYPMLPTIPLSAFSDPKKNKPSHG
SKDANKESGKASKPHKVAREHRERPRKDSESRSCSKEPEREPKSAKDAARKLPKEEKAPV
PKAAFKEPKMALKETKLESLSPKGVSQPPTLPKASSKRPAATDSPKPSAKKPKKSGSKGA
RRAPGTSPRASSFPDKKVARDKSSKGDKGKMESEPREAKRTLQAEDSNSEDEASFRSESA
QSSPAHASSSSDSSSDSDFEPSQNHSQGPLRSMVEDLQSEGSDEDDSSSGEESTVKTNPG
RESRLSFSDSESDNSADSCLPGREPLPPQKPPPPSSKVTGRRSPEPCSKPEKILKKATYD
KAYTDELVELHRRLMALRERNVLQQIVNLIEETGHFNVTNTTFDFDLFSLDESTVRKLQS
CLEAVAT
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atggacaatcagtgcaccgtccaggtgaagttagagctggggcatcgtgcccagctgcgg
aagaaacccaccactgagggcttcacccatgactggatggtttttgtgcgtggccctgaa
cagtgtgacatccagcactttgtggagaaggtcatcttccgactgcatgacagcttcccc
aagcccaagcgtgtgtgcaaggagcctccctacaaagtggaggagtcaggctacgcaggc
ttcatcatgctcatcgaagtgtacttcaaaaacaaggaggagccgaggaaggtctgcttc
acctacgacctgttcctcaacctggagggcaaccctcctgtcaaccacctgcgctgtgag
aagctcaccttcaacaaccccaccactgagtttcgctgcaagctactcatggccggcggg
gtgatggtaatgcccgaaggagcggacacggtgtccaggcccagccctgactaccccatg
ttacccacaattccactctctgccttctctgaccccaagaagaacaaaccatcccacggt
tccaaggacgccaacaaggagagtggcaaggcttccaaaccacacaaggtggccagggag
caccgtgagcggccgcgtaaggactcagagagcaggagttgctccaaggagccagagcgc
gagcccaagagtgccaaggatgctgcacgcaagctgcccaaggaggagaaggccccagtg
cccaaggctgccttcaaggagcccaagatggccctaaaggaaaccaagctggagagcctg
tcccctaagggtgtgtcccagcctcctaccctgcccaaggcctccagcaagaggccagct
gccacagactcaccgaagcccagcgccaaaaagcctaagaagagtgggtcaaagggggca
cggcgtgcgccaggcacctcaccccgtgcctcctccttccctgacaagaaggtggccagg
gacaagagcagcaaaggtgacaaggggaagatggagagtgagccaagggaggccaagcgg
actctgcaggctgaggactcaaactctgaggatgaggcctccttccggtcagagtcggcc
cagtcaagcccagctcacgccagctccagctctgactccagctctgactccgactttgag
ccgtctcagaaccacagccaaggacccctgcgctccatggtggaggacctacagtctgag
gggtcagatgaggatgactcatcatcaggagaggagagcaccgtcaagaccaacccaggc
cgggagtccaggctaagcttcagtgacagcgagagtgacaacagtgctgactcctgcctg
cctggccgtgagcccctgcctccccagaagccaccccctccgagcagcaaggtgactggt
cggaggagccccgagccctgcagcaagcctgaaaagattctgaagaaggctacctacgac
aaggcttacacggacgagctggtggagctacaccggaggctgatggctctgcgtgagcgc
aatgtgctgcagcagatcgtcaacctgatcgaggagactggtcacttcaatgtcaccaac
accaccttcgactttgaccttttttccttggatgaaagcactgttcgcaagctgcagagc
tgcctggaggccgtggccacatga

DBGET integrated database retrieval system