KEGG   Rattus norvegicus (rat): 301120
Entry
301120            CDS       T01003                                 

Gene name
Acsbg2
Definition
(RefSeq) acyl-CoA synthetase bubblegum family member 2
  KO
K15013  long-chain-fatty-acid--CoA ligase ACSBG [EC:6.2.1.3]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00061  Fatty acid biosynthesis
rno00071  Fatty acid degradation
rno01100  Metabolic pathways
rno01212  Fatty acid metabolism
rno03320  PPAR signaling pathway
rno04920  Adipocytokine signaling pathway
Module
rno_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    301120 (Acsbg2)
   00071 Fatty acid degradation
    301120 (Acsbg2)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    301120 (Acsbg2)
   03320 PPAR signaling pathway
    301120 (Acsbg2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:rno01004]
    301120 (Acsbg2)
Enzymes [BR:rno01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     301120 (Acsbg2)
Lipid biosynthesis proteins [BR:rno01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   301120 (Acsbg2)
SSDB
Motif
Pfam: AMP-binding Cas_Cas2CT1978
Other DBs
NCBI-GeneID: 301120
NCBI-ProteinID: NP_001073565
RGD: 1588580
Ensembl: ENSRNOG00000045947
UniProt: A1L1K7
Position
9q12
AA seq 667 aa
MTQEKKAEDPDRGMDTTSAAPRLWSTHCDGEVLLRLSKHGPGHETPMTIPELFQESVERF
GAYPALASKNGKKWDTLTFSQYYDVCRKAARSLIKLGLQRFHGVGILGFNSVEWVVAALG
AILAGGLCVGIYATNSAEACQYVIKQANVNVLIVENDQQLQKILSIPPDKMETVKAIVQY
RLPLMENSTNLYSWQDFMELGNAIPNIQLDRVILSQKANQCAVIIYTSGTTGSPKGVMLS
HDNITWTAGAMAREIELIHVSGKQDTIVSYLPLSHIAAQLMDIWIPIKVGVLTFFAQPDA
LRGTLVYTLQEVKPTYFLGVPRVWEKMQDTIKENVAKSSNLRKKAFAWAKMLGLKVNTKK
MLGKRDIPMNYRMAKALVFTKVRTSLGLDNCHTFFSGASPLSQDVSEFFLSLDIPIGEIY
GMTECSGPHTVSCKSIYRVLSCGKVLNGCKNMLYKQNKDGVGEVCMWGRHVFMGYLGKED
ATLEVLDEDGWLHSGDIGRLDSHDFLYITGRIKEVLITAGGENIWPIPIETLVKEKIPII
SHAMLVGDKAKFLSMLLTLKCETDQMSGEPLDKLNLEAISFCQMLGSQAVTVSDILKIRD
PVVYTAIQYGIDIVNQQAVSDSHRIRKWIILEKDFSIQGGELGPTSKLKRDLITQKYKAQ
IDNMYSS
NT seq 2004 nt   +upstreamnt  +downstreamnt
atgactcaagagaagaaggcagaagaccctgatagaggcatggacaccacctcagctgcc
cccaggctgtggagcactcactgtgatggagaggtgctgctgaggctgtccaaacatggg
ccaggccatgagaccccaatgaccatccctgagctgtttcaggaatctgttgaacgattc
ggcgcttatccagccctagcctcgaagaacggcaaaaagtgggacacgctcacgttcagc
cagtactatgacgtgtgtcgaaaggcagccagatctctgatcaagctgggtctgcagcgt
ttccatggcgttggcatcctgggctttaactcggttgagtgggtcgttgctgctctgggc
gccatcttggctgggggcctctgtgttggtatttatgccaccaactcggccgaggcctgc
cagtacgtcatcaagcaggccaacgtgaatgtcttgatagtggagaatgaccaacagctg
cagaaaatcctgtcgattccaccagacaagatggagaccgtgaaagccattgtgcagtac
aggctgcccttgatggaaaacagcacaaacctgtactcctggcaggacttcatggagctg
ggtaatgccatccccaacatacagctggaccgggtcatcctcagccagaaggccaaccag
tgtgctgtcatcatctatacctctgggaccacagggagccccaaaggcgtgatgctgagt
catgacaacatcacatggacggcaggggccatggcgcgagagattgagctgatccacgtc
tcaggaaagcaggacacgatagtcagctacctgcccctcagccacattgcagcccagctc
atggacatctggatccctatcaaagtcggggtgctcactttctttgctcaaccagatgct
ctcaggggcaccttggtgtacactcttcaagaggtgaagcctacttatttcctgggggtg
ccacgcgtctgggaaaagatgcaggacaccatcaaggaaaatgtggccaagtcctccaac
ctgagaaaaaaggcatttgcatgggcaaagatgcttggcttgaaggtcaataccaagaag
atgctggggaagcgagacatccccatgaattaccgcatggcaaaggcccttgtgttcacg
aaggtcagaacctccctgggcttggacaactgccacaccttcttcagtggggcttcaccc
ctctctcaggatgtctcggagttctttctcagcctggatatccccattggtgagatctat
gggatgactgagtgttccggaccccacacagtctcctgcaagagtatctacagagttctg
agttgtggcaaagtcctgaatggctgtaagaatatgctgtacaagcagaacaaagatggt
gtgggtgaggtgtgcatgtggggccgccatgtcttcatgggctacctgggtaaggaggat
gccacgttggaagtattggatgaagatggttggctgcactctggggacattggccgcctg
gacagccacgatttcctttatatcaccggccgcatcaaagaagtcctgataactgctggt
ggtgagaacatatggcccatcccaattgagaccctggtgaaagagaaaatccccatcatc
agccatgccatgctggtgggtgacaaggccaaattcctgagcatgctgttgacactgaag
tgtgagacagaccagatgagtggagagcccttggacaagctgaacctggaggccatcagc
ttctgccagatgctgggtagccaagcagtcactgtgtcggacattttgaagattcgagac
ccagtggtctacacggccatccagtatggcatagacatcgtgaatcagcaagcagtctct
gactcacatagaattcgaaagtggatcatcttggagaaagacttttccatccagggtggg
gagctgggaccaacatcaaaacttaagagagatctcataacccagaaatacaaagcacag
attgacaacatgtactcatcataa

DBGET integrated database retrieval system