KEGG   Rattus norvegicus (rat): 301121Help
Entry
301121            CDS       T01003                                 

Gene name
Rfx2
Definition
(RefSeq) regulatory factor X2
  KO
K09173  regulatory factor X 1/2/3
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    301121 (Rfx2)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Other basic domains
   RF-X
    301121 (Rfx2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RFX1_trans_act RFX_DNA_binding Pox_D5 DUF2258
Motif
Other DBs
NCBI-GeneID: 301121
NCBI-ProteinID: NP_001100347
RGD: 1588579
Ensembl: ENSRNOG00000045846
UniProt: B2GV50
Position
9q12
AA seq 692 aa AA seqDB search
MQNSEGGADSPATVALRPAAQPVPASPQRVLVQAAGSTPKGTPMQTLTLPRVQPVPPQVQ
HVYPAQVQYVEGGDAVYANGAIRAAYTYNPDPQLYAPSSAASYFETPGGAQVTVAASSPP
AVPSHGMVGITMDVSGTPIVSGAGTYLIHGGMDSTRHSLAHTARSSPATLQWLLDNYETA
EGVSLPRSSLYNHYLRHCQEHKLEPVNAASFGKLIRSVFMGLRTRRLGTRGNSKYHYYGI
RLKPDSPLNRLQEDTQYMAMRQQPTHQKPRYRPAQKSDSLGDGSAHSNMHSTPEQAMAAQ
GQHHQQYIDVSHVFPEFPAPDLGSTLLQESVTLHDVKALQLVYRRHCEATLDVVMNLQFQ
YIEKLWLSFWNCKATSSDGRASLPASDEEPEVTLLPKDKLISLCKCEPILQWMRSCDHIL
YQALVETLIPDVLRPVPSSLTQAIRNFAKSLEGWLINAMSGFPQQVIQTKVGVVSAFAQT
LRRYTSLNHLAQAARAVLQNTSQINQMLSDLNRVDFANVQEQASWVCQCEESLVQRLEHD
FKVTLQQQSSLDQWASWLDNVVTQVLKQHAGSPSFPKAARQFLLKWSFYSSMVIRDLTLR
SAASFGSFHLIRLLYDEYMFYLVEHRVAQATGETPIAVMGEFNDLASLSLTLLDKEDIGD
GHSSEADVDGRSLGEPLVKRERSDPSHPLQGI
NT seq 2079 nt NT seq  +upstreamnt  +downstreamnt
atgcagaactccgagggaggagcagactcgcctgccacagtggctctgcgtcctgcagcc
cagcctgtaccagcctccccacagagggtgctggtacaagccgcaggctccactcccaag
ggtaccccgatgcagacactcaccctccccagagtccagccagtgccaccacaggtgcag
cacgtgtaccccgcacaggtgcagtacgtggagggtggggatgctgtctacgccaacgga
gccatccgagccgcctatacctacaacccagaccctcagctctacgcccccagcagcgca
gcttcttactttgagactccaggtggcgctcaggtgacggtggcagcctcgtccccacca
gcggttccctcccacggcatggtgggcatcaccatggatgtctcagggacccccattgtg
tctggcgcaggaacctacctcatccacgggggcatggacagcacaagacactccctggcc
cacactgcccgctcgtcacctgccacgctccagtggcttctggacaattacgagacagca
gagggtgtgagcctgccccgcagctccctgtacaaccactacctgcgccactgccaggag
cacaagctggagccagtcaatgctgcatccttcggcaagctcatccgctctgtattcatg
ggcctgcgcacacgacgcttggggaccaggggcaactcaaagtaccattactatgggatc
cgcctgaagccagactcaccactgaatcgactgcaggaagacacacagtacatggccatg
aggcagcagcccacgcaccagaagcctaggtatcggccagcccagaagtcagacagcctc
ggggatggcagtgctcacagcaacatgcacagcacacccgagcaagccatggccgcccag
ggccagcatcaccagcagtacatagatgtgtcccacgtcttcccagagttcccagcacct
gacctaggcagcacgttactgcaggagagtgtcacccttcatgatgtgaaggccctgcag
ctggtgtatcgcaggcactgtgaggccaccttagatgtcgtcatgaacctccagtttcag
tacattgagaagctgtggttgtccttctggaactgcaaggccacctccagtgatggccgt
gcctcgctgcctgccagcgacgaggagcctgaagtcaccctcctccccaaggacaagctc
atctctctgtgtaagtgtgagcccatcctgcagtggatgcgcagctgcgatcacatcctg
taccaggcgctggtggagaccctcatcccagacgtgctacggcccgtgcccagttccctc
acacaggccatcaggaacttcgccaagagcctggagggctggctcatcaatgccatgagt
ggcttccctcagcaggtcatccagaccaaggtgggtgttgtaagtgcctttgcacagaca
ctgcggcgctacacgtccctcaaccacctggcacaggcagcacgtgccgtgctacagaat
acgtcacagattaaccagatgctgagtgacctcaaccgcgtggactttgccaatgtgcag
gagcaggcctcatgggtgtgccagtgtgaggagagcctggtgcagcgtttggagcatgac
ttcaaggtcaccctgcagcagcagagctcgctggaccaatgggccagctggctggacaat
gtggtcacccaggtactgaagcagcatgcaggcagccccagcttccccaaggctgcacgg
cagttcctgctcaagtggtccttctacagctccatggtaatccgggacctgaccctgcgc
agcgctgccagctttggctccttccacctcatccgcctgttgtatgacgagtacatgttc
tacctggtggagcaccgtgtggcccaggccaccggggagacacccattgctgtcatgggc
gagttcaatgacctggcgtccctgtcgctgaccctgctggacaaagaggacattggggac
ggacacagcagtgaggcagatgtggatggccgcagcctgggcgagcccctggtgaagcgg
gaacggagtgaccccagccacccactgcagggcatctag

DBGET integrated database retrieval system