KEGG   Rattus norvegicus (rat): 301155Help
Entry
301155            CDS       T01003                                 

Gene name
St6gal2, ST6Gal-II, ST6GalII
Definition
(RefSeq) ST6 beta-galactoside alpha-2,6-sialyltransferase 2
  KO
K00779  beta-galactoside alpha-2,6-sialyltransferase (sialyltransferase 2) [EC:2.4.99.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00510  N-Glycan biosynthesis
rno00514  Other types of O-glycan biosynthesis
rno01100  Metabolic pathways
Module
rno_M00075  N-glycan biosynthesis, complex type
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    301155 (St6gal2)
   00514 Other types of O-glycan biosynthesis
    301155 (St6gal2)
Enzymes [BR:rno01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.1  beta-galactoside alpha-(2,6)-sialyltransferase
     301155 (St6gal2)
Glycosyltransferases [BR:rno01003]
 Terminal extension
  Sialyltransferase
   301155 (St6gal2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_29
Motif
Other DBs
NCBI-GeneID: 301155
NCBI-ProteinID: NP_001094358
RGD: 1559663
Ensembl: ENSRNOG00000046515
UniProt: Q701R3
Position
9q11
AA seq 525 aa AA seqDB search
MKPHLKQWRQRMLFAIFVWGLLFLAIFIYFTNSNPAAPMPSSFSFLESRGLLPVQGKQRV
IMGALQEPSLPRSLEPSKVLMDGHSASPFNSWPGDPQKGDQAQDGFDNGDEFFTSQVGRK
SQSAFYPEEDNYFFVAGQPGLYHHRQGALGLPSPGESSWQSGPGQPKQEKLRHPRRGSLP
EEAYDSDMLSTSMSRAFLYRLWKGTVSSKMLNPRLQKAMRYYMSFNKHGVRFSRRGRREA
RRTGPELLCEMRKRVRVRTLDGKEAPFSGLGWRPLVPGVPLSQLHPRGLRSCAVVMSAGA
ILNSSLGEEIDSHDAVLRFNSAPTRGYEKDVGNKTTVRIINSQILANPSHHFIDSSLYKD
VILVAWDPAPYSANLNLWYKKPDYNLFTPYIQHRLKYPTQPFYILHPKFIWQLWDIIQEN
TREKIQPNPPSSGFIGILVMMSMCQEVHVYEYIPSVRQTELCHYHELYYDAACTLGAYHP
LLYEKLLVQRLNTGTQADLHHKGKVVLPGFQTLRCPVTRPNNTNT
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccacacttgaagcaatggcgacaacgaatgctctttgcaatatttgtttggggg
ctcctctttttggcaattttcatctatttcaccaacagcaatcctgctgcacctatgccc
agctccttttccttcctggagagccgcgggctcctgcctgtgcagggcaagcagagggtc
atcatgggtgcattgcaggagccctctttgcccagaagtttggagccaagcaaagtactg
atggacggccactctgcgagccctttcaacagctggcctggggacccacagaaaggggac
caggcccaagatggctttgacaatggggatgagttttttacatcccaggtcgggaggaaa
tcacaaagtgctttctatcctgaggaagacaactacttttttgttgcgggtcagcctggg
ttgtaccaccaccggcagggtgccctggggctgccatctccgggggagtcctcatggcaa
tcaggacctggtcagcccaagcaggagaagctgcgtcacccaaggagaggcagtttgcct
gaggaagcctatgatagtgacatgctgtcgacctccatgtccagagccttcctgtaccgg
ctctggaagggaaccgtgtcctctaagatgttgaacccgcgcctgcagaaagccatgcgc
tactacatgtcctttaacaagcacggtgtgcgcttcagcaggcgggggcggcgtgaggca
cgacgtacagggccagagctgctgtgcgagatgcgcaagcgtgtgcgtgtgcgcaccttg
gacggcaaagaggcgcccttctcagggctgggctggcggcctctggtacctggggtccct
ctgagccagttgcacccccgcggtttgcgcagctgcgcagttgtaatgtctgccggagcc
atcctgaactcctccttgggggaggaaatcgattctcatgatgcagttttgagatttaac
tctgcccctacacgtggctatgagaaagatgtcggaaataaaaccacagtacgcatcatt
aattctcagattctggccaaccccagccatcacttcattgacagttctttatataaagat
gttattctggtagcctgggatccagctccttattctgccaatcttaacctgtggtataag
aagccagattacaaccttttcactccatatatccagcatcgcctgaaatacccaactcag
ccattttacattcttcaccccaaattcatatggcagctttgggacattatccaggaaaac
acaagggagaagatacagcccaacccaccatcttctggttttattggaatcctcgtcatg
atgtccatgtgccaagaggtgcacgtgtatgagtacatcccatctgtcagacagacagaa
ctttgccactaccatgagctgtactacgacgcagcctgcaccttgggagcctaccaccca
ttgctttatgaaaagctactggtgcagcgccttaacacaggcacccaggcagatttgcac
cacaagggaaaggtggtcctgccaggcttccagactctgcggtgcccagtaaccaggccc
aacaatacaaacacttaa

DBGET integrated database retrieval system