KEGG   Rattus norvegicus (rat): 301246
Entry
301246            CDS       T01003                                 

Gene name
Polr1c
Definition
(RefSeq) DNA-directed RNA polymerases I and III subunit RPAC1
  KO
K03027  DNA-directed RNA polymerases I and III subunit RPAC1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03020  RNA polymerase
rno04623  Cytosolic DNA-sensing pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    301246 (Polr1c)
 09150 Organismal Systems
  09151 Immune system
   04623 Cytosolic DNA-sensing pathway
    301246 (Polr1c)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:rno03021]
    301246 (Polr1c)
Transcription machinery [BR:rno03021]
 Eukaryotic type
  RNA polymerase III system
   RNA polymerase III
    Core subunits
     301246 (Polr1c)
  RNA polymerase I system
   RNA polymerase I
     301246 (Polr1c)
SSDB
Motif
Pfam: RNA_pol_A_bac RNA_pol_L
Other DBs
NCBI-GeneID: 301246
NCBI-ProteinID: NP_001008331
RGD: 1309689
Ensembl: ENSRNOG00000019079
UniProt: Q5RJK9
Position
9
AA seq 346 aa
MAAAQAVEEMRTRVVLGEFGVRNVHTTDFPGNYSGYDDAWDQDRFEKNFRVDVVHMDEST
LEFDMVGIDAAIANAFRRILLAEVPTMAVEKVLVYNNTSIVQDEILAHRLGLIPILADPR
LFEYRNPGEEEGTEIDTLQFRLQVRCTRNPSAAKDSSDPNELYVNHKVYTRHMTWVPLGN
QADVFPEGTVRPVHDDILIAQLRPGQEIDLMMHCVKGIGKDHAKFSPVATASYRLLPDIT
LLEPVEGEAAEELSQCFSPGVIAVQEVQGKKVARVANARLDTFSREIFRHEKLKKAVRLA
RVRDHYIFSVESTGVLPPDVLVSEAIKILMGKCRRFLDELDAVEMD
NT seq 1041 nt   +upstreamnt  +downstreamnt
atggcggctgctcaggcggtggaggaaatgcggactcgcgtggttctgggagagtttggg
gttcgcaatgtccacaccactgactttcccggtaactactccggttatgatgatgcctgg
gaccaggaccggttcgagaagaacttccgtgtggacgtggtgcatatggacgagagcaca
ctggagttcgacatggtggggattgatgctgccattgccaatgccttccggaggattctg
ttagctgaggtgccaacaatggctgtggaaaaggttttggtgtataacaacacatccatc
gtccaggatgagatccttgctcaccgcctggggcttatccccattcttgctgatccacgt
ctctttgaatatcggaacccaggagaggaggagggaacagagatagatacactacagttt
cggctgcaggtcaggtgtaccaggaaccccagtgctgctaaggattcttccgaccccaat
gaactctatgtgaaccacaaagtttataccaggcacatgacgtgggtgcccttgggaaac
caggctgatgtcttcccggagggcacggttcgccctgtgcatgacgacatcctcattgcc
cagcttcggcccggccaggagattgacctgatgatgcactgcgtcaagggcatcggcaaa
gaccatgccaagttctcaccggtggccacagccagctacaggctcctgccggacatcacc
ctgcttgaacctgtagaaggggaagcagccgaggagctgagccagtgcttctcacccggc
gtgattgcggtgcaggaagtacaaggtaaaaaggtggccagggttgccaatgctcggctg
gataccttcagcagggagatcttccgtcatgagaagctcaagaaggccgtgcggcttgcc
cgtgttcgggaccattacatcttttctgtggagtcaactggggttttgccaccagatgtg
ttggtgagtgaagctatcaagatcctgatggggaagtgccggcggttcttggatgaacta
gatgcagttgagatggactga

DBGET integrated database retrieval system