KEGG   Rattus norvegicus (rat): 301252Help
Entry
301252            CDS       T01003                                 

Gene name
Hsp90ab1, HSP90-BETA, HSP90B, HSPC2, Hspcb
Definition
(RefSeq) heat shock protein 90 alpha family class B member 1
  KO
K04079  molecular chaperone HtpG
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04141  Protein processing in endoplasmic reticulum
rno04151  PI3K-Akt signaling pathway
rno04217  Necroptosis
rno04612  Antigen processing and presentation
rno04621  NOD-like receptor signaling pathway
rno04657  IL-17 signaling pathway
rno04659  Th17 cell differentiation
rno04914  Progesterone-mediated oocyte maturation
rno04915  Estrogen signaling pathway
rno05200  Pathways in cancer
rno05215  Prostate cancer
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    301252 (Hsp90ab1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    301252 (Hsp90ab1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    301252 (Hsp90ab1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    301252 (Hsp90ab1)
   04612 Antigen processing and presentation
    301252 (Hsp90ab1)
   04659 Th17 cell differentiation
    301252 (Hsp90ab1)
   04657 IL-17 signaling pathway
    301252 (Hsp90ab1)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    301252 (Hsp90ab1)
   04914 Progesterone-mediated oocyte maturation
    301252 (Hsp90ab1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    301252 (Hsp90ab1)
  09162 Cancer: specific types
   05215 Prostate cancer
    301252 (Hsp90ab1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    301252 (Hsp90ab1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rno01009]
    301252 (Hsp90ab1)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:rno03110]
    301252 (Hsp90ab1)
   04131 Membrane trafficking [BR:rno04131]
    301252 (Hsp90ab1)
   03051 Proteasome [BR:rno03051]
    301252 (Hsp90ab1)
   03029 Mitochondrial biogenesis [BR:rno03029]
    301252 (Hsp90ab1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    301252 (Hsp90ab1)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     301252 (Hsp90ab1)
Chaperones and folding catalysts [BR:rno03110]
 Heat shock proteins
  HSP90
   301252 (Hsp90ab1)
Membrane trafficking [BR:rno04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    301252 (Hsp90ab1)
Proteasome [BR:rno03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    301252 (Hsp90ab1)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-independent mechanism factors
    301252 (Hsp90ab1)
Exosome [BR:rno04147]
 Exosomal proteins
  Proteins found in most exosomes
   301252 (Hsp90ab1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP90 HATPase_c HATPase_c_3
Motif
Other DBs
NCBI-GeneID: 301252
NCBI-ProteinID: NP_001004082
RGD: 1303075
Ensembl: ENSRNOG00000019834
UniProt: P34058
Position
9q12
AA seq 724 aa AA seqDB search
MPEEVHHGEEEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNASDALDKIRYESLT
DPSKLDSGKELKIDIIPNPQERTLTLVDTGIGMTKADLINNLGTIAKSGTKAFMEALQAG
ADISMIGQFGVGFYSAYLVAEKVVVITKHNDDEQYAWESSAGGSFTVRADHGEPIGRGTK
VILHLKEDQTEYLEERRVKEVVKKHSQFIGYPITLYLEKEREKEISDDEAEEEKGEKEEE
DKEDEEKPKIEDVGSDEEDDSGKDKKKKTKKIKEKYIDQEELNKTKPIWTRNPDDITQEE
YGEFYKSLTNDWEDHLAVKHFSVEGQLEFRALLFIPRRAPFDLFENKKKKNNIKLYVRRV
FIMDSCDELIPEYLNFIRGVVDSEDLPLNISREMLQQSKILKVIRKNIVKKCLELFSELA
EDKENYKKFYEAFSKNLKLGIHEDSTNRRRLSELLRYHTSQSGDEMTSLSEYVSRMKETQ
KSIYYITGESKEQVANSAFVERVRKRGFEVVYMTEPIDEYCVQQLKEFDGKSLVSVTKEG
LELPEDEEEKKKMEESKAKFENLCKLMKEILDKKVEKVTISNRLVSSPCCIVTSTYGWTA
NMERIMKAQALRDNSTMGYMMAKKHLEINPDHPIVETLRQKAEADKNDKAVKDLVVLLFE
TALLSSGFSLEDPQTHSNRIYRMIKLGLGIDEDEVTAEEPSAAVPDEIPPLEGDEDASRM
EEVD
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaggaagtgcaccatggagaggaagaggtggagaccttcgcctttcaggcagaa
attgcccagctgatgtccctcatcatcaacactttctactcaaacaaagagattttcctc
cgggagttgatctctaatgcttctgatgccctggacaagattcggtatgagagcctgact
gacccttccaagttggacagcgggaaagagctgaagattgacatcatccccaaccctcag
gaacgcacgctgactttggtggacacaggcattggcatgaccaaggctgacctcataaat
aacttgggaaccattgctaagtctggtacaaaggcgttcatggaggctctccaggctggt
gcagacatctccatgattgggcagtttggtgtcggcttctactctgcctacctggtggca
gagaaagtggttgtgatcacgaagcacaacgatgatgagcagtatgcctgggagtcttct
gctggtggatccttcactgtccgtgcagaccacggtgagcccattggccggggtaccaaa
gtgatccttcacctcaaagaagaccagacagagtacttagaggagaggagggtcaaggag
gtggtgaagaaacactcacagttcataggctaccccatcaccctctatctggagaaggaa
cgcgagaaggagatcagtgatgatgaggcagaggaagagaaaggggagaaggaggaggaa
gataaggaggatgaggagaagcctaagattgaggatgtgggatctgatgaggaggatgac
agcggcaaagataagaaaaagaaaacaaagaagatcaaggagaagtacattgaccaggaa
gagctgaataagacgaagcccatctggaccagaaatcctgatgacatcactcaagaggaa
tatggtgaattctacaagagcctcaccaatgactgggaagaccacttggcagtcaagcac
ttctctgtagaagggcagttggaattcagggcattgctcttcattccccggcgagctccc
tttgacctctttgagaacaagaagaagaagaacaacatcaaattgtatgtccgtcgtgtg
ttcatcatggacagctgtgatgagctgatacctgagtacctcaacttcatccgtggtgtg
gttgattccgaggacctgcctctgaacatctcccgagaaatgctccagcagagcaagatc
ctgaaagtcatccgcaaaaacattgtgaagaagtgccttgagctcttctctgagttggct
gaagacaaagagaactacaagaaattttatgaggcattctctaagaatttaaagcttgga
atccatgaggattccactaaccgtcgccgcctctctgagctccttcgctaccatacctct
cagtctggagatgagatgacttccctgtcagagtatgtgtctcgcatgaaggagacacag
aagtccatctactatatcactggtgagagcaaagagcaggtggccaactctgccttcgtg
gagcgtgtgcggaaacggggctttgaggtggtatacatgactgagcccattgatgagtac
tgcgtacagcagctcaaggagttcgatggcaagagcctggtctccgtgaccaaggagggc
ctggagctaccagaggatgaggaagagaagaaaaaaatggaggagagcaaggcaaagttt
gagaatctctgcaagctcatgaaggagatcttggacaagaaggttgaaaaagtgactatc
tccaataggcttgtgtcttccccctgctgcattgtgaccagcacctacggctggacagcc
aacatggaacggattatgaaggcccaggcactgcgggacaactcgacaatgggctacatg
atggccaagaaacacctagagatcaaccctgaccaccccattgtggagactctgcggcag
aaggctgaggcagacaaaaacgacaaagctgtcaaagacctggtggtgctgctgtttgag
actgctctgctctcctctggcttctcacttgaggacccccaaacccactccaaccgcatc
taccgcatgattaaactaggcctgggcattgatgaagatgaggtcactgcagaagagccc
agtgctgctgttcccgatgagatccccccactggagggtgatgaggatgcctctcgcatg
gaagaagtggattaa

DBGET integrated database retrieval system