KEGG   Rattus norvegicus (rat): 301265
Entry
301265            CDS       T01003                                 

Symbol
Pla2g7
Name
(RefSeq) platelet-activating factor acetylhydrolase precursor
  KO
K01062  platelet-activating factor acetylhydrolase [EC:3.1.1.47]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00565  Ether lipid metabolism
rno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00565 Ether lipid metabolism
    301265 (Pla2g7)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.47  1-alkyl-2-acetylglycerophosphocholine esterase
     301265 (Pla2g7)
SSDB
Motif
Pfam: PAF-AH_p_II Chlorophyllase2 Peptidase_S9 Abhydrolase_1 Chlorophyllase Hydrolase_4 Abhydrolase_2 Abhydrolase_6 Lipase_3 Abhydrolase_3 DLH PvlArgDC Pardaxin
Other DBs
NCBI-GeneID: 301265
NCBI-ProteinID: NP_001009353
RGD: 1310734
Ensembl: ENSRNOG00000025691
UniProt: Q5M7T7
Position
9
AA seq 440 aa
MVPLKLRVLFCLLCCLPRVHPLYWQDPSFFDFRPSVMFHKLQSVMSAVSAGRCKIPKGNG
SYPVGCTDMMFGYGNESIFLRLYYPAQDQGPHDTVWVPNIEYFWGLSKFLGTPTFVGNIL
RLLYGSLTAPASWNFPLRTGEKYPLIIFSHGLGAFRTIYSAIGAALASYGFIVATVEHRD
GSASATYYFEDQAAAKMENRSWFYLKKIKQEESERARKEQVRQRAKECSKALSAILDIEH
GNPKENVLGLPFDMKQLKDSIDETKIAVMGHSFGGATVFQALSEDQRFRCGIALDPWMFP
VSEELYSRVPQPLFFINSAEFQTPKDIAKMKNFYQPDKERKMITIKGSVHQNFADGTFVT
GKIIGNKLSLKGDIDSRVAIDLTNKASLAFLQKHLGLHKDFDQWDCLVEGENENLIPGSP
FDVVTQSPALQSSPGSHNQN
NT seq 1323 nt   +upstreamnt  +downstreamnt
atggtgccgctcaaactgcgcgtgcttttctgcctcctctgctgcctcccacgggtacat
cctttgtactggcaagacccttcttttttcgacttcaggccatcagtaatgtttcataag
ctccaatcggtgatgtctgctgtcagcgctggccgttgtaaaatccccaaaggaaatgga
tcttaccctgtcggctgtacagacatgatgttcggttatgggaatgagagcatcttcttg
cgtttgtactacccagctcaagatcaaggtcctcatgacactgtttgggtcccaaacata
gaatatttttggggtcttagtaaatttctcggaacacctacttttgtaggcaacattttg
cgcctcttatatggttctctgacagctcctgcaagctggaattttcctttgcggactgga
gaaaaatacccactaattatcttttctcacggtctcggagccttcaggacaatttattct
gctattggcgctgctttggcatcctatgggtttatagtggccactgtggaacatagagac
ggatctgcatccgcaacttactattttgaagaccaggcagctgcgaaaatggaaaacagg
tcttggttttacctgaaaaagataaaacaagaggagtcggaaagagctcggaaagagcag
gttcggcagagagcaaaagaatgttccaaggctctcagtgcaattcttgacattgaacat
ggaaacccaaaagagaatgtactaggtttaccttttgatatgaaacagctgaaggattct
atcgatgagactaaaatagctgtgatggggcattcttttggaggagcaacagtttttcaa
gccctaagtgaagaccagagattcagatgtgggattgcccttgatccgtggatgtttccc
gtgagtgaggagctgtactccagagttcctcagcctctcttctttatcaactctgccgaa
ttccagactccaaaggacattgcaaaaatgaaaaacttctaccagcctgacaaggaaagg
aaaatgattacgatcaagggctcagtgcaccagaattttgctgacgggacttttgtaact
ggcaaaataattggaaacaagctgtcactgaaaggagacatagactccagagttgccata
gacctcaccaacaaggcttccttggctttcttacaaaaacatttaggacttcataaagac
tttgatcagtgggactgtctggtggagggagagaacgagaacctcatcccggggtcaccc
tttgatgtagtcacccagtccccggctctgcagagttctcccggatcacacaaccagaat
tag

DBGET integrated database retrieval system