KEGG   Rattus norvegicus (rat): 301291
Entry
301291            CDS       T01003                                 

Gene name
Il17f, IL-17F
Definition
(RefSeq) interleukin 17F
  KO
K05494  interleukin 17F
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04657  IL-17 signaling pathway
rno04659  Th17 cell differentiation
rno05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    301291 (Il17f)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    301291 (Il17f)
   04657 IL-17 signaling pathway
    301291 (Il17f)
 09160 Human Diseases
  09163 Immune disease
   05321 Inflammatory bowel disease
    301291 (Il17f)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    301291 (Il17f)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Interleukins
   301291 (Il17f)
SSDB
Motif
Pfam: IL17
Other DBs
NCBI-GeneID: 301291
NCBI-ProteinID: NP_001015011
RGD: 1311398
Ensembl: ENSRNOG00000012509
UniProt: Q5BJ95
Position
9q13
AA seq 161 aa
MKGSCETTMVKSLLLLMLGFAIISSGAARRNPKVGLSALQKAGNCPPLEDNSVRVDIRIF
NQNQGISVPRDFQNRSSSPWDYNITRDPDRFPSEIAEAQCRHSGCINAQGQEDGSMNSVP
IQQEILVLRREPQGCSNSFRLEKMLIKVGCTCVTPIVHHAA
NT seq 486 nt   +upstreamnt  +downstreamnt
atgaagggctcctgtgaaacaaccatggtcaagtctctgctgctgttgatgttgggattt
gccatcatcagctcgggagcagctcggaggaaccccaaagtagggctttctgctctgcag
aaagccgggaactgccctcccctggaggataacagtgtgagagttgacattcgcatcttc
aatcaaaaccagggcatttctgtcccacgtgacttccagaaccgctccagttccccatgg
gattacaatatcacccgagaccccgaccggttcccctcagagatcgctgaggcccagtgc
agacactcaggctgtatcaacgcccaggggcaggaagacggctccatgaactccgtcccc
atccagcaagaaatcctggtccttcggagggagccccagggctgttctaattccttcagg
ttggagaagatgctcataaaagttggctgcacttgcgtcacgcccatcgtccaccacgcg
gcctga

DBGET integrated database retrieval system