KEGG   Rattus norvegicus (rat): 301295
Entry
301295            CDS       T01003                                 

Gene name
Efhc1
Definition
(RefSeq) EF-hand domain-containing protein 1
  KO
K23029  EF-hand domain-containing protein 1
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    301295 (Efhc1)
   04990 Domain-containing proteins not elsewhere classified [BR:rno04990]
    301295 (Efhc1)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Microtubule-associated proteins (MAPs)
     301295 (Efhc1)
Domain-containing proteins not elsewhere classified [BR:rno04990]
 EF-hand domain-containing proteins
  Other EF-hand domain-containing proteins
   301295 (Efhc1)
SSDB
Motif
Pfam: DUF1126 EF-hand_7 EF-hand_6 EF-hand_1 DUF5580
Other DBs
NCBI-GeneID: 301295
NCBI-ProteinID: NP_001116419
RGD: 1587365
Ensembl: ENSRNOG00000042729
UniProt: D3ZD71
Position
9
AA seq 648 aa
MVTNPVHGLPLLPGSSFTDSTKTAFHRSQTLGYRNGYAFVRRPTMGIGGDRLPYNQLSPA
ELDELANKAPILTYGPLKQAAPAEFVPAHVAFDKKVLKFSAYFQEDVPISMEEHYRIRRV
NIYYYLEDDSMSVIEPVVENSGIPQGKLVKRQRLAKNDVGDHYHWKDLNRGINLTIYGKT
FRIVDCDRFTQDFLESQGIELNPSEKMPLDPYTELRKEPVRKYVTPSDFDQLKQFLTFDK
QVLRFYAIWDDTDSLFGECRHYIIHYYLMDDTVEIREVHERNNGRDPFPLLMNRQRMPKV
LVDNGKNFPQCVLEISDQEVLEWYTAKDFIVGKPLTILGRTFFIYDCDPFTRQFYKDKFG
MSDLPRVDVSKKEPPPVKQELPPYNGYGLIEDSAQNCFALVPKAPRKDIVKMLMNDNKVL
RYLAALESPIPEDKDRRFVFSYFLATDMISIFEPPVRNSGIIGGKFLGRTKVVKSFSPVD
NPIYYGPSDFFIGAVIEVFGHRFVILDTDEYVLKYMESNASQYSPEALASIQNRIRKQDS
PAPELECKQATEETKALATEELKAQGLDKLIEKIQMHLKDISCKDNLRERFQVYDKEESG
YVDKETFFKVCETLNVPVDDSLIKELIRLCTHGEGRINYYNFVRAFSD
NT seq 1947 nt   +upstreamnt  +downstreamnt
atggtgaccaacccggtgcacggcctgcccttactcccgggctcgtcctttacggactcc
acgaaaacagcattccacagaagccagacactcggctacaggaatggctatgcatttgtc
cgacgtccaaccatgggcataggtggagaccggctcccctacaaccaactgtctccggct
gagctggatgagttggccaataaggcacccatcttgacttatggcccactcaagcaggcc
gcaccagcagagtttgttcctgcgcatgtggcttttgacaaaaaggtgctgaaatttagc
gcctacttccaagaagatgttcccatatcaatggaggagcattaccgaatccgccgggtg
aacatttactactacctagaggatgacagcatgtctgtcatcgagcctgtcgtggagaac
tctgggatcccacaaggcaagctagtcaaacgccagcgactagccaagaatgatgtggga
gaccactaccactggaaggacctgaaccgtggaatcaaccttacaatttatggcaaaacc
ttccgcattgttgactgcgaccgattcactcaggattttttggaaagtcaaggcattgaa
ttaaatccatcagagaagatgcctctagacccttacactgaactccgaaaagaacctgtt
cgaaaatatgtcaccccatcagactttgaccaactgaagcagtttctcacctttgacaaa
caagtccttcgattctacgcgatctgggacgacacggatagcttgtttggagagtgtcgc
cactacatcattcattactacctcatggatgacactgtggagatccgtgaggtccacgaa
cggaacaacgggagggaccccttcccactcctcatgaaccgacagcgcatgcccaaagtt
ttggtggataacggaaagaatttccctcagtgtgtgctggaaatctccgatcaagaggtg
ttagagtggtacactgccaaggacttcatcgtgggaaagccactcaccatcctcgggagg
accttcttcatttatgactgtgatccgttcacccgacagttctacaaagacaagtttgga
atgtccgatttaccacgagttgacgtgagcaagaaggagccgcctcctgtaaaacaggag
ttgcctccttataatggttatgggctaatcgaagactctgctcagaattgttttgctctc
gttcccaaagctcccagaaaagatattgttaagatgctgatgaacgacaacaaggtgctc
cgctacctggcggcactggaatcccctatcccagaagacaaagaccgtcgctttgtcttc
tcttattttcttgccacagatatgatcagtatctttgagccacctgttcgaaattctggg
atcatcggaggcaaattcctgggcaggactaaagttgttaaatcattctctccagtcgac
aaccccatctactatggaccaagtgacttcttcatcggtgctgtgattgaggtgttcggt
catcggtttgttatccttgatacagatgagtatgttttaaaatacatggagagcaatgct
tcccagtactcaccagaagccctcgcctcaatccagaaccgtatccggaagcaggattct
cctgcaccagaactggaatgcaagcaagctacagaagaaaccaaggcactggctacagag
gaactcaaggcacagggcctggacaaactgatagaaaaaatccagatgcacctgaaggac
atttcatgcaaagacaacctccgggaaaggttccaagtatacgacaaggaggaatcggga
tatgtggacaaagagacgttctttaaagtctgcgaaactcttaatgtcccagtcgacgac
tcgttgattaaggagttgatcaggctgtgcacccatggagaaggcaggattaactactat
aactttgttcgagctttctcggactga

DBGET integrated database retrieval system