KEGG   Rattus norvegicus (rat): 301346Help
Entry
301346            CDS       T01003                                 

Gene name
Sema4c, RGD1562837
Definition
(RefSeq) semaphorin 4C
  KO
K06521  semaphorin 4
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    301346 (Sema4c)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:rno04090]
    301346 (Sema4c)
CD molecules [BR:rno04090]
 Proteins
  301346 (Sema4c)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sema PSI Ig_2 I-set Ig_3 LapA_dom
Motif
Other DBs
NCBI-GeneID: 301346
NCBI-ProteinID: NP_001100372
RGD: 1562837
Ensembl: ENSRNOG00000016254
Vega: OTTRNOG00000000836
UniProt: D4A9J3
Position
9q21
AA seq 834 aa AA seqDB search
MAPHWAVWLLAAGLWGLGIGAEMWWNLAPRKTVSSGELVTVVRRFSQTGIQDFLTLTLTD
RSGLLYVGAREALFAFSVEALELQGVISWEAPAEKKIECTQKGKSNQTECFNFIRFLQPY
NASHLYVCGTYAFQPKCTYINMLTFTLDRAEFEDGKGKCPYDPAKGHTGLLVDGELYSAT
LNNFLGTEPVILRNMGPHHPIKTEYLAFWLNEPHFVGSAFVPESVGSFTGDDDKIYFFFS
ERAVEYDCYSEQVVARVARVCKGDMGGARTLQKKWTTFLKARLVCSAPDWKVYFNQLRAV
HTLLGASWHNTTFFAVFQARWGDMDLSAVCEYQLEHIQQVFEGPFKEYSEQAQKWARYTD
PVPTPRPGSCINNWHRDNGYTSSLELPDNTLNFIKKHPLMEEQVKPRLGRPLLVKKNTNF
THVVADRILGLDGATYTVLFIGTGDGWLLKAVSLGPWIHMVEELQVFDQEPVESLVLSQS
KKVLFAGSRSQLVQLSLADCTKYRFCVDCVLARDPYCAWNVNTSRCVATGGHSGSLLVQH
VANLDPSKMCIQYAIKKARPVVPKNITVVAGTDLVLPCHLSSNLAHALWTFRGRDLPAEQ
PGSFLYDTGLQALVVMAAQSRHSGPYHCYSEEQGTKLAAESYLVSVVAGSSVTLEARAPL
ENLGLVWLAVVALGAVCLVLLLLVLSLRRRLREELEKGSKAAERTLVYPLELPKEPASPP
FRPGPETDEKLWDPVGYYYSDGSLKIVPGHARCQPGGGPPSPPPGIPGQPLPSPTRLHLG
GGRNSNANGYVRLQLGGEDREGSGHPLPEIADELRRKLQQRQPLPDSNPEESSV
NT seq 2505 nt NT seq  +upstreamnt  +downstreamnt
atggccccacactgggctgtctggctgctggcagcagggctgtggggcctgggcattggg
gctgagatgtggtggaaccttgcgcctcggaagactgtatcttctggggagctggtcaca
gtagtgaggcggttctcccagacaggcatccaggacttcctgaccctgaccctgacagac
cgttctggcctattatatgtgggggcccgggaggcgctgtttgccttcagcgtagaggct
ctggagcttcaaggagtgatctcctgggaggctccagctgagaagaaaattgagtgtacc
cagaaagggaagagcaaccagaccgagtgcttcaacttcatccgcttccttcagccatac
aacgcctcccatctgtacgtttgtggtacctatgccttccagcccaagtgcacctacatc
aacatgctcacgttcaccttggatcgtgcagaatttgaggacgggaagggtaaatgccct
tacgacccagctaagggccacactggactccttgtggatggtgaactgtactcggctaca
ctcaataacttcctgggcacagagccggttatccttcgaaacatggggccccaccacccc
atcaagacggagtacctggctttttggttgaatgaacctcactttgtaggctctgccttt
gtccctgagagtgtgggaagcttcacgggagatgatgacaagatctacttcttcttcagt
gagcgggcagtggagtatgactgctactccgagcaggtggtggctcgagtggcacgagtc
tgtaagggtgacatggggggagcacggaccctgcagaagaagtggacaacgttcctgaaa
gctcggttggtgtgctcagccccggattggaaggtctacttcaaccagctgcgggcagtg
cacaccctgctgggcgcctcctggcacaacaccaccttcttcgcggtttttcaagctcga
tggggtgatatggacctgtcagcagtctgcgagtaccagttggaacatatccagcaggtg
tttgagggtcccttcaaggagtacagcgagcaagcccagaagtgggcccgctatactgac
ccagtacccaccccccggcccggttcgtgcatcaacaactggcaccgagacaatggctac
accagttctctggagctgcccgacaacacccttaacttcatcaagaagcacccgctgatg
gaggaacaggtgaagcctcggttgggccgccccctacttgtaaagaagaacacgaacttc
acacatgtggtggccgacaggatcctaggacttgatggcgccacctatacagtgttgttc
attggtacaggagatggttggctgctgaaagctgtaagcctggggccctggatccacatg
gtggaggagctgcaggtgtttgaccaggagccagtggaaagtctggtgctgtctcagagc
aagaaggtgctgtttgctggctcccgttctcaactggttcagctgtcgctggcggactgc
acgaagtatcgcttctgtgtagactgtgtccttgccagggacccctactgtgcctggaat
gtcaacaccagccgctgtgtggccaccggtggtcattcagggtcccttctggtccaacac
gtggcaaatttggacccttcaaagatgtgtatccagtatgccattaaaaaagccagacct
gttgttcccaaaaatatcacagttgtagcaggcacagacctggtcctaccctgccacctc
tcctccaatttggctcatgccctctggaccttcagaggccgggacctgcctgcagaacaa
cctggctccttcctttatgacacgggactccaggcgctggtggtgatggccgcccagtcc
cgccactctgggccctatcattgctattcagaggagcaggggacaaaactggctgcagaa
agctaccttgtttctgtcgtggctggctcatcggtgaccctggaggcacgggctcccttg
gaaaacctggggcttgtgtggctagccgtggtggccctgggggctgtgtgcctggtgttg
ctgctgttggttctctcgctccgccggcgcctgcgagaagagctggaaaagggttccaag
gcagccgagaggacactggtgtaccccctggaactgcccaaggagccagccagtcccccc
ttccgtcctggcccagaaaccgatgagaaactttgggatcctgttggttactactattca
gatggctctctcaagattgtgcctggtcacgcccggtgccagcccgggggtgggccccct
tccccacctcctggcatccccggccagcccttgccttctccaactcggcttcacctagga
ggtggtcggaactcaaatgccaacggttatgtgcgcttacagttgggtggagaggaccga
gaaggatctgggcacccactgcctgagattgctgatgaattacgacggaaactgcagcag
cgccagccgctgcctgactccaacccagaggagtcttcagtatga

DBGET integrated database retrieval system