KEGG   Rattus norvegicus (rat): 301348
Entry
301348            CDS       T01003                                 

Gene name
Zap70
Definition
(RefSeq) tyrosine-protein kinase ZAP-70
  KO
K07360  tyrosine-protein kinase ZAP-70 [EC:2.7.10.2]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04014  Ras signaling pathway
rno04064  NF-kappa B signaling pathway
rno04650  Natural killer cell mediated cytotoxicity
rno04658  Th1 and Th2 cell differentiation
rno04659  Th17 cell differentiation
rno04660  T cell receptor signaling pathway
rno05135  Yersinia infection
rno05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
rno05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    301348 (Zap70)
   04064 NF-kappa B signaling pathway
    301348 (Zap70)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    301348 (Zap70)
   04660 T cell receptor signaling pathway
    301348 (Zap70)
   04658 Th1 and Th2 cell differentiation
    301348 (Zap70)
   04659 Th17 cell differentiation
    301348 (Zap70)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    301348 (Zap70)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    301348 (Zap70)
  09163 Immune disease
   05340 Primary immunodeficiency
    301348 (Zap70)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    301348 (Zap70)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     301348 (Zap70)
Protein kinases [BR:rno01001]
 Non-receptor tyrosine kinases
  SYK family
   301348 (Zap70)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase SH2 ABC1 Haspin_kinase Kdo RIO1
Other DBs
NCBI-GeneID: 301348
NCBI-ProteinID: NP_001012002
RGD: 3983
Ensembl: ENSRNOG00000016995
UniProt: A0A0R4J8U1
Position
9
AA seq 614 aa
MPDPAAHLPFFYGSISRAEAEEHLKLAGMADGLFLLRQCLRSLGGYVLSLVHDVRFHHFP
IERQLNGTYAIAGGKAHCGPAELCQFYSQDPDGLPCNLRKPCNRPPGLEPQPGVFDCLRD
AMVRDYVRQTWKLEGDALEQAIISQAPQVEKLIATTAHERMPWYHSSLTREEAERKLYSG
QQTDGKFLLRPRKEQGTYALSLVYGKTVYHYLISQDKAGKYCIPEGTKFDTLWQLVEYLK
LKADGLIYRLKEVCPNSSASAEAAAPTLPAHPSTFTQPHRRIDTLNSDGYTPEPARLDKP
RPMPMDTSVYESPYSDPEELKDKKLFLKRENLLVADIELGCGNFGSVRQGVYRMRKKQID
VAIKVLKQSTEKADKDEMMREAQIMHQLDNPYIVRLIGVCQAEALMLVMEMAGGGPLHKF
LIGKKEEIPVSNVAELLHQVAMGMKYLEEKNFVHRDLAARNVLLVNRHYAKISDFGLSKA
LGADDSYYTARSAGKWPLKWYAPECINFRKFSSRSDVWSYGVTMWEAFSYGQKPYKKMKG
PEVLDFIKQGKRMECPPECPPEMYALMSDCWIYKWEDRPDFVAVEQRMRTYYYSMASRAE
GPPQCEQVAEAACG
NT seq 1845 nt   +upstreamnt  +downstreamnt
atgcccgaccccgcggcgcatctgccattcttctacggaagcatttcgcgggccgaggcc
gaggagcacctgaagctggcaggcatggccgacggactgttcctcctgcgccagtgcctg
cgctcgctgggcggctacgtgctgtcgctagtacacgacgtgcgcttccaccatttcccc
atcgagcgccaactcaatggcacgtacgccatcgcgggcggcaaggcgcactgcggcccg
gccgagctctgccagttctactcgcaggaccccgacggactgccctgcaatctgcgtaag
ccatgcaaccggccgccgggacttgagcctcagcccggggtcttcgactgcctgcgcgat
gctatggtgcgggactacgtgcgccagacctggaaactggagggtgatgcactagagcag
gccatcatcagccaggccccacaggtggagaagctcattgctaccacagcccacgagcga
atgccctggtaccacagcagcctgactcgcgaggaggctgagcgcaaactctattctggc
cagcagaccgacggcaagttcctgctgagaccccggaaggagcagggcacatatgcgctg
tccctggtctacgggaaaactgtgtaccactatctcatcagccaggacaaggctggcaag
tactgtatccccgaaggcaccaagtttgatacgctctggcagctggtggagtacctgaag
ctgaaggcagatggactcatttatcgcctgaaggaggtctgtcccaacagcagtgccagc
gccgaagctgctgcacccacgctcccagcccacccatccacattcactcagcctcacaga
cgaattgataccctgaactcagacggatacacccctgaaccagcacgcttagacaagcca
cgaccgatgcccatggacacgagcgtgtacgagagcccctacagcgaccccgaggaactc
aaggacaagaagctcttcctgaagcgagagaacctcctcgtggccgacatcgaacttggt
tgcggcaactttggctcagtgcgccagggagtctaccgcatgcgcaagaagcagatcgac
gtggccatcaaggtgctaaagcagagcacagagaaagctgacaaggatgagatgatgcgg
gaggcccagatcatgcatcagctcgacaacccctacattgtgcggctcatcggcgtgtgc
caggcagaggcgctcatgctggtcatggagatggcaggaggcgggccactgcacaagttc
ctgattggaaaaaaggaggagatcccggtgagcaacgtggctgaactgctgcaccaggtg
gccatgggcatgaagtatttggaggagaagaactttgtgcaccgtgacctggcagcccgg
aatgttctactggtcaatcggcactatgccaagatcagcgactttggcctgtccaaggca
ctgggtgctgatgacagctattacacagcccgttctgcagggaagtggcctctgaagtgg
tacgcaccagaatgcatcaacttccggaagttctccagccgcagtgatgtctggagctat
ggggtcaccatgtgggaggccttctcctatggccagaagccctacaagaagatgaagggc
cctgaggtcctggatttcatcaagcagggtaagaggatggaatgccctccagagtgtccg
cccgaaatgtacgcgcttatgagtgactgctggatatacaagtgggaggatcgtcccgat
ttcgtggctgtggaacaacgaatgaggacctattactacagcatggctagccgggcagag
ggacccccacagtgtgaacaggtggccgaggctgcatgtggctga

DBGET integrated database retrieval system