KEGG   Rattus norvegicus (rat): 301372Help
Entry
301372            CDS       T01003                                 

Gene name
Gpr45
Definition
(RefSeq) G protein-coupled receptor 45
  KO
K08409  G protein-coupled receptor 45
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    301372 (Gpr45)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Others
   Orphan GPCRs / unclassified GPCRs
    301372 (Gpr45)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 PLAC8
Motif
Other DBs
NCBI-GeneID: 301372
NCBI-ProteinID: NP_001100376
RGD: 1306253
Ensembl: ENSRNOG00000016446
UniProt: D4A8X5
Position
9q22
AA seq 373 aa AA seqDB search
MACNSTPIGTYQHLLLNASNTLDPGATPLSAPLRISLAIMMLLMIVVGFLGNTVVCIIVY
QRPAMRSAINLLLATLAFSDIMLSLCCMPFTAITLVTVRWHFGDHFCRLSATLYWFFVLE
GVAILLIISVDRFLIIVQRQDKLNPRRAKVIIAASWVLSFCISAPSFTGWTFMEVPARAP
QCVLGYTEFPAERAYVVTLVVAVFFAPFGVMLCSYLCILNTVRKNAVRVHNQSDSLDLRH
LSGAGLRRLRRQQQQASLDLSFKTKAFTTILILFVGFSLCWLPHSVYSLLSAFSRRFYYS
ASFYTTSTCVLWLSYLKSVFNPIVYCWRIKKFREACIELLPQTFQILPKVPERIQRKIQP
STVYVCNENQSTV
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atggcctgtaacagcacgcccatcgggacgtaccaacatctgctgctgaacgcgagcaac
actctggaccctggggccaccccactgtccgcaccgctcaggatttcgctggcaataatg
atgctgctgatgattgtggtaggattcctcggcaacacggtggtctgcatcatcgtgtac
cagaggccagccatgcgatcagccatcaacttactgctggccaccctggccttctccgac
atcatgctgtccttatgctgcatgcctttcaccgccatcaccctcgtcactgttcgatgg
cacttcggggaccacttttgtcggctttcagctactctctattggttttttgtcctggag
ggcgtggccatcctgcttatcattagtgtggaccgatttctcatcatcgtgcagcgtcag
gacaagctgaacccacgcagagctaaggtgatcatcgcggcctcctgggtgctgtctttc
tgcatctctgcgccctcattcactggctggacgttcatggaggtgcctgctcgggcccca
cagtgcgtgctgggctacactgagttcccagctgaacgtgcctatgtggtgacactggtg
gtggcagttttctttgcgcctttcggcgtcatgctgtgctcctatctgtgcatcctcaat
acggtgcggaagaatgctgtccgtgtgcacaaccagtcggacagcctggacctcagacat
ctgtcgggggctggcctgagacgtcttcggcggcagcagcagcaggccagcctggacctg
agcttcaaaaccaaggccttcaccaccatcctcatcctcttcgtgggcttttcgctctgc
tggctgccgcattcggtctacagcctgctgtctgcgttcagccggcggttctattacagc
gcctccttctacaccaccagcacgtgcgtcctgtggctcagttacctcaagtctgtcttc
aaccccatcgtctactgctggaggatcaaaaaattccgcgaggcctgcatagagttgctt
ccccaaaccttccaaatcctccctaaagtgcctgagcggatccagaggaaaatccagcca
agcaccgtctatgtgtgcaacgaaaaccaatccactgtctag

DBGET integrated database retrieval system