KEGG   Rattus norvegicus (rat): 301416Help
Entry
301416            CDS       T01003                                 

Gene name
Coq10b, RGD1359509
Definition
(RefSeq) coenzyme Q10B
  KO
K18588  coenzyme Q-binding protein COQ10
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99987 Cofactor metabolism
    301416 (Coq10b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Polyketide_cyc
Motif
Other DBs
NCBI-GeneID: 301416
NCBI-ProteinID: NP_001009671
RGD: 1359509
Ensembl: ENSRNOG00000014456
UniProt: Q5I0I9 A0A0G2JSW8
Position
9q31
AA seq 242 aa AA seqDB search
MIMAARTSQRTLARVASGCRPKSTTVTEARVRGSARNVRYLAPCGILMNRTLAPWASVLP
KEICARTFFRITTPLVNKRKEYSERRIIGYSMQEMYDVVSGMEDYKHFVPWCKKSDILSR
RSGYCKTRLEIGFPPVLERYTSIVTLVKPHLVKASCTDGKLFNHLETVWRFSPGLPGYPR
TCTLDFSISFEFRSLLHSQLATLFFDEVVKQMVAAFERRACKLYGPETNIPRELMLHEIH
HT
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgatcatggcagctcggactagtcagaggactctggctagggtggcatcgggatgccgt
ccgaagtcaaccacagtgacggaagcccgggtgcgagggtctgcgcgcaacgtcaggtac
ttagctccctgtggtatactgatgaacagaacccttgcaccgtgggcctcagttttgcct
aaagagatctgtgcaagaaccttcttcagaatcactacaccattagtaaataagcgaaag
gagtattcagagagaagaattatagggtactccatgcaggaaatgtatgatgtagtatca
ggaatggaagattataaacattttgttccttggtgtaaaaagtcagatatattatcaagg
agatctggatattgtaaaacccgattagaaattgggtttccccctgttttggagcgatac
acatcaatagtgaccttggtaaaaccacatttggtaaaggcctcttgtactgatgggaaa
cttttcaatcatctggagactgtttggcgattcagcccaggtcttcctggctatccaaga
acatgtaccttggatttttcaatttcttttgaattccgctcccttctgcactctcagctc
gctacactgttctttgatgaagttgtgaaacaaatggtagcggcctttgaaagaagagct
tgtaaactgtatggtccagagacaaacattcctcgggaattaatgcttcatgaaattcac
cacacctga

DBGET integrated database retrieval system