KEGG   Rattus norvegicus (rat): 301442Help
Entry
301442            CDS       T01003                                 

Gene name
Sumo1
Definition
(RefSeq) small ubiquitin-like modifier 1
  KO
K12160  small ubiquitin-related modifier
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03013  RNA transport
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    301442 (Sumo1)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    301442 (Sumo1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    301442 (Sumo1)
   03029 Mitochondrial biogenesis [BR:rno03029]
    301442 (Sumo1)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    301442 (Sumo1)
Ubiquitin system [BR:rno04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitin-like proteins (UBLs)
   301442 (Sumo1)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    301442 (Sumo1)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Septins
   Septin associated proteins
    301442 (Sumo1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Rad60-SLD ubiquitin
Motif
Other DBs
NCBI-GeneID: 301442
NCBI-ProteinID: NP_001009672
RGD: 1306919
Ensembl: ENSRNOG00000016133
UniProt: Q5I0H3
Position
9q31
AA seq 101 aa AA seqDB search
MSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMN
SLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGGHSTV
NT seq 306 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaccaggaggcaaaaccttcaactgaggacttaggagataagaaagaaggagaa
tacattaaactcaaagttattggacaggacagcagtgagatccatttcaaagtgaaaatg
acaacacatctcaagaagctcaaagaatcgtactgtcaaagacagggagttccaatgaat
tcactcaggtttctctttgaaggtcagagaattgctgataatcatactccaaaagaactg
ggaatggaggaagaagacgtgattgaagtttatcaggaacaaacggggggtcactcgacg
gtttag

DBGET integrated database retrieval system