KEGG   Rattus norvegicus (rat): 301442
Entry
301442            CDS       T01003                                 

Gene name
Sumo1
Definition
(RefSeq) small ubiquitin-related modifier 1
  KO
K12160  small ubiquitin-related modifier
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03013  RNA transport
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    301442 (Sumo1)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    301442 (Sumo1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    301442 (Sumo1)
   03029 Mitochondrial biogenesis [BR:rno03029]
    301442 (Sumo1)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    301442 (Sumo1)
Ubiquitin system [BR:rno04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitin-like proteins (UBLs)
   301442 (Sumo1)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    301442 (Sumo1)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Septins
   Septin associated proteins
    301442 (Sumo1)
SSDB
Motif
Pfam: Rad60-SLD ubiquitin
Other DBs
NCBI-GeneID: 301442
NCBI-ProteinID: NP_001009672
RGD: 1306919
Ensembl: ENSRNOG00000016133
UniProt: Q5I0H3
Position
9
AA seq 101 aa
MSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMN
SLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGGHSTV
NT seq 306 nt   +upstreamnt  +downstreamnt
atgtctgaccaggaggcaaaaccttcaactgaggacttaggagataagaaagaaggagaa
tacattaaactcaaagttattggacaggacagcagtgagatccatttcaaagtgaaaatg
acaacacatctcaagaagctcaaagaatcgtactgtcaaagacagggagttccaatgaat
tcactcaggtttctctttgaaggtcagagaattgctgataatcatactccaaaagaactg
ggaatggaggaagaagacgtgattgaagtttatcaggaacaaacggggggtcactcgacg
gtttag

KEGG   Rattus norvegicus (rat): 499417
Entry
499417            CDS       T01003                                 

Gene name
Sumo3
Definition
(RefSeq) small ubiquitin-related modifier 3
  KO
K12160  small ubiquitin-related modifier
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03013  RNA transport
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    499417 (Sumo3)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    499417 (Sumo3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    499417 (Sumo3)
   03029 Mitochondrial biogenesis [BR:rno03029]
    499417 (Sumo3)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    499417 (Sumo3)
Ubiquitin system [BR:rno04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitin-like proteins (UBLs)
   499417 (Sumo3)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    499417 (Sumo3)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Septins
   Septin associated proteins
    499417 (Sumo3)
SSDB
Motif
Pfam: Rad60-SLD ubiquitin DUF5010_C
Other DBs
NCBI-GeneID: 499417
NCBI-ProteinID: NP_001019466
RGD: 1561022
Ensembl: ENSRNOG00000038489
UniProt: Q5XIF4
Position
20
AA seq 110 aa
MSEEKPKEGVKTENDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFR
FDGQPINETDTPAQLEMEDEDTIDVFQQQTGGTASRASVPTPSHFPDICY
NT seq 333 nt   +upstreamnt  +downstreamnt
atgtcggaagagaagcccaaggagggtgtgaagacagagaacgaccacatcaacctgaaa
gtggcagggcaggatggctcagtggtgcagttcaagatcaagaggcacactccgctgagc
aagctgatgaaggcctactgtgagaggcagggcttgtcaatgaggcagattcgattccgg
tttgatggacaaccaatcaacgaaacagacactccagcccagctggagatggaggatgag
gacaccattgatgtattccagcagcagacgggaggaacggcctcccgagccagcgtcccc
acacccagccattttcctgacatttgctattga

KEGG   Rattus norvegicus (rat): 682787
Entry
682787            CDS       T01003                                 

Gene name
Sumo4
Definition
(RefSeq) small ubiquitin-related modifier 2
  KO
K12160  small ubiquitin-related modifier
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03013  RNA transport
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    682787 (Sumo4)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    682787 (Sumo4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    682787 (Sumo4)
   03029 Mitochondrial biogenesis [BR:rno03029]
    682787 (Sumo4)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    682787 (Sumo4)
Ubiquitin system [BR:rno04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitin-like proteins (UBLs)
   682787 (Sumo4)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    682787 (Sumo4)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Septins
   Septin associated proteins
    682787 (Sumo4)
SSDB
Motif
Pfam: Rad60-SLD ubiquitin
Other DBs
NCBI-GeneID: 682787
NCBI-ProteinID: XP_002729504
RGD: 1595256
Ensembl: ENSRNOG00000032840
UniProt: F1LN30
Position
5
AA seq 95 aa
MADEKPKEGVKTENNDHINLKAVGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRF
EFDGQPINETDTPAQLEMEDEDTIDVFRQQTGGVY
NT seq 288 nt   +upstreamnt  +downstreamnt
atggccgacgagaaacccaaggaaggagtcaagactgagaacaacgaccatattaatttg
aaggcggtgggacaggatggttctgtggtgcagtttaagattaagaggcatacaccactt
agtaaactaatgaaagcctattgtgaacggcagggtttgtcaatgaggcagatcagattc
gagtttgatgggcaaccaatcaacgaaacagacacacctgcacagttggaaatggaggat
gaagatacgattgatgtgttccggcagcagacaggtggtgtctactaa

KEGG   Rattus norvegicus (rat): 690244
Entry
690244            CDS       T01003                                 

Gene name
Sumo2
Definition
(RefSeq) small ubiquitin-related modifier 2
  KO
K12160  small ubiquitin-related modifier
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03013  RNA transport
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    690244 (Sumo2)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    690244 (Sumo2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    690244 (Sumo2)
   03029 Mitochondrial biogenesis [BR:rno03029]
    690244 (Sumo2)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    690244 (Sumo2)
Ubiquitin system [BR:rno04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitin-like proteins (UBLs)
   690244 (Sumo2)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    690244 (Sumo2)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Septins
   Septin associated proteins
    690244 (Sumo2)
SSDB
Motif
Pfam: Rad60-SLD ubiquitin DUF5010_C
Other DBs
NCBI-GeneID: 690244
NCBI-ProteinID: NP_598278
RGD: 621761
Ensembl: ENSRNOG00000003670
UniProt: P61959
Position
10
AA seq 95 aa
MADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRF
RFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVY
NT seq 288 nt   +upstreamnt  +downstreamnt
atggccgacgagaaacccaaggaaggagtcaagactgagaacaacgatcatattaatttg
aaggtggcgggacaggatggttctgtggtgcagtttaagattaagaggcatacaccactt
agtaaactaatgaaagcctattgtgaacggcagggtttgtcaatgaggcagatcagattc
cggtttgatgggcaaccaatcaacgaaacagacacacctgcacagttggaaatggaggat
gaagatacgattgatgtgttccagcagcagacaggaggcgtctactga

DBGET integrated database retrieval system