KEGG   Rattus norvegicus (rat): 301455
Entry
301455            CDS       T01003                                 

Gene name
Pard3b
Definition
(RefSeq) par-3 family cell polarity regulator beta
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: Par3_HAL_N_term PDZ PDZ_6 PDZ_2
Other DBs
NCBI-GeneID: 301455
NCBI-ProteinID: NP_001178737
RGD: 1584992
Ensembl: ENSRNOG00000024345
UniProt: F1LW22
Position
9q32
AA seq 1203 aa
MKVTVCFGRTGIVVPCKDGQLRVSELTQQALQRYLKTRDQDPGYWVKIHHLEYTDGGILD
PDDVLADVVEDKDKLIAVFDEQEPLQKIESPSGNPVDRQSPDAFDTEVAAQLAAFKPIGG
EIVVTPSALKLGTPLLVRRSSDPAPGPHADAQPSTASPSGQSLKPVVLDSAQNLENRDVM
NGEQTGLLMLHKTKNELSDMTRAVEISGEGDPLGIHVVPFFSSLSGRILGLFIRGIEENS
RCKQEGLFQENECIVKINNVELLDKTFAQAQDVFRQAMKSPSVVLHVLLPQNREQYEKSV
IGQLNIFGNNDSASRTKAPPPTRGKAGLKAVNPTRANSPEGEESPSPQQSKSPRVPRLGR
KPSSPSLSPLMGFGSKKNAKKIKIDLKKGPEGLGFTVVTRDSSIHGPGPIFVKNILPKGA
AVKDGRLQSGDRILEVNGRDVTGRTQEELVAMLRSTKQGETVSLVIARQEGSFLPRELKG
EPDCYALSLESSEQLTLEIPLNDSGSAGLGVSLKGNKSRETGTDLGIFIKSIIHGGAAFK
DGRLRMNDQLIAVNGETLLGKSNHEAMETLRRSMSMEGNIRGMIQLVILRRLERPLEEIS
ECGALSRPCFENCQEALSASRRNDSSLLYPCGTYSPQDKRKDLLLPSDGWAENEVPPSPP
PHPSLEWGLEDFSHSSRVDSTGYFPDQHVNFRIVTPVGQPESINLKASKSMDLVPDESKV
QSLADRRSDSPGKDFGPTLGLKKSSSLESLQTAVAEVRKNDLPFHRPRPHMVRGRGCNES
FRAAIDKSYDGPEEAEADGLSDKSSHSGHTALNCESAPQGNPELDDVENKAKNVKKTKEK
EKKKGKGKMKVKEKKQKEEHEDTERKMKRKGFGAMLRFGKKKDDKVGKTEQKGTQKSGHP
GEEELERMKEERERIGAKHQELREKQARGLVDYATVATGPVHDIDDDEMDPNYARVNHFR
EPCTSANVFRSPSPPRAGTLGYPRDGRPLSPDHLEGLYAKVNKPYHPPALADSGRPMAGT
TDRIQKLRKEYYQARREGFLLYEDEEGVTRPSDYDLHWVSGKGPDGSAHNLRFEGMERQY
ASLPRGGSADPVDYLTASPRGRYNERELPYYPGPHPVHSPRGSYPRPPDLRVTDLRYPQY
YPPPPAHQHKGPFRQDVPPSPPQHQRVPVYQEMGRAGPRGGSPDQYPYRNQDPRQKNPMT
AAV
NT seq 3612 nt   +upstreamnt  +downstreamnt
atgaaagtgacagtgtgcttcgggaggaccggcatcgtggtgccctgcaaggacggccag
ctgcgcgtcagcgagctcacccagcaggcgctgcagcggtacctgaagacccgggaccag
gatcctggatactgggtgaagattcatcacttggaatacacagatggaggaatcctggat
ccagatgatgtcttagcagatgtcgttgaagataaagataagctgattgctgtgtttgac
gaacaagagccactccaaaagattgagagccccagtggaaaccctgtggatcggcagagc
ccagatgctttcgacacagaagtggctgcccaactggctgcgtttaaaccaatcggcggg
gaaattgtagtaaccccttctgctctgaagttaggcactccgctgctggttaggagaagc
agtgacccagcaccagggccccatgctgatgcccagccaagcactgcaagccccagtggc
cagagcttgaaacctgttgttctggattctgcccagaacttggaaaacagagacgttatg
aatggtgaacagacagggctacttatgctgcacaaaacgaagaatgaactgagtgatatg
acgagagctgtggagatttctggggaaggagatcccttggggatacatgtggtgcccttc
ttttcatccctgagtggcaggatcctaggactcttcatccgaggcatcgaagaaaacagc
aggtgcaagcaggagggactatttcaggaaaacgaatgcattgtaaaaatcaacaacgtg
gaactcctggacaaaacttttgctcaggcccaagatgtcttccgtcaggcaatgaaatct
cccagtgtggtcctccatgtgcttctgcctcaaaatcgtgaacaatatgaaaaatcagtc
attggacaactgaacatttttggcaacaatgacagtgcttcaagaacaaaggcaccacct
cccacccgtgggaaagcagggctaaaggcagtaaatccaacaagagcaaacagccctgaa
ggagaggagtcaccttccccgcagcaaagcaagagtccccgagttccaagattaggaaga
aaaccttcctctccctcactctcccctctcatggggtttggcagcaagaaaaatgcaaaa
aaaattaagattgaccttaagaaaggccccgaaggacttggtttcactgtggtaactaga
gattcttctatacatggtcctggtcccatttttgtaaaaaatatcctaccaaagggagca
gcagtaaaggatggccgcctacaatcaggagacagaattttagaggtaaatggcagagat
gtcacaggaagaacccaggaagaacttgtggccatgctgaggagcactaagcagggagag
acggtatcactggtcattgcccgccaagaagggagcttcctgccccgagagctgaaagga
gaacctgattgctatgcactctccctggaatcaagcgagcagctcaccttggagatcccc
ctgaatgattccggctctgctggtcttggagttagcctgaaagggaataaatctcgagaa
actgggactgacttggggatttttatcaaatccatcatccatggaggtgctgctttcaag
gatggccgtctccgaatgaatgaccaactgattgctgttaatggggaaactcttctggga
aagtccaaccatgaagccatggaaacactgaggagatccatgtccatggaaggaaacatc
cggggcatgatccagttagtgattctgaggagactggagagaccactggaggagatttca
gaatgtggagcactttccagaccatgctttgagaactgtcaagaagctctgagcgcctcc
aggcgaaatgatagtagtttattatatccgtgtggcacctatagtccacaagataaaagg
aaagacctattgcttcccagtgatgggtgggctgagaatgaagtaccgccgtccccgcca
ccacatcccagtctggaatggggccttgaagacttcagtcacagctctagagtggattcc
acaggatattttccagatcaacatgtcaatttcagaattgtgacaccagtcgggcagccc
gaatcaattaacctgaaagcctccaagagcatggaccttgtgccagacgaaagcaaagtc
cagtcactggctgatcgcaggtcagactctccaggcaaagattttggtccaaccctgggc
ctgaaaaagtccagttccttggagagcctacagactgctgtggctgaagtcaggaagaat
gatctgcccttccacagacccagaccacacatggtgcgaggccggggctgcaatgagagc
ttccgagcagccattgacaaatcttacgacgggccagaagaggcagaagctgatggtctg
tctgataagagctctcactcgggccacacagctctgaattgtgagtctgcccctcaggga
aaccctgagctagatgatgtggaaaataaagccaagaacgtcaaaaaaacaaaagagaag
gagaagaaaaaaggaaagggcaagatgaaagtcaaggaaaaaaagcagaaagaggaacat
gaggacacagagaggaaaatgaagaggaagggcttcggcgccatgctgagattcggaaag
aagaaagatgataaagttgggaaaacggaacagaaaggtacacagaagtccgggcaccca
ggagaagaagagctggaaaggatgaaggaagaaagggagaggattggagcaaaacatcag
gagctaagagaaaagcaggcgagaggccttgttgattatgccactgtagcgactggacca
gtgcacgatatagacgacgatgaaatggaccccaattatgccagagtgaaccactttcgg
gaaccatgcacatcagcaaatgtctttagatctccatctcctcctcgagctggaacactt
ggttaccctagggatggacgcccactgtctccagaccacttagagggtctctatgccaag
gtcaacaagccatatcatccaccagccctagctgacagtggacgacccatggcaggaacc
actgaccgcatccagaagcttcggaaggagtactaccaggctcggagagaagggttcctt
ttgtatgaagacgaagagggagtaacaaggccgtctgactatgacctgcactgggtgtct
ggaaagggtccagacgggagcgcacacaacctccgctttgaggggatggagcggcagtat
gcatccttacccaggggaggctcagcagatcctgtggactacctgacagcttcaccccga
gggcgctacaatgaaagagagcttccatactacccagggcctcatcctgtgcattcccca
agagggagctatcccagacccccggatctgagggtgaccgatctacgatacccacagtac
tacccacccccaccagcccatcagcataaaggacccttcagacaagatgttcctccgtca
ccacctcagcaccagagagtaccagtctaccaggagatgggcagggcagggccccgaggg
ggcagccctgaccagtacccctatcgtaaccaggatcccaggcagaagaatcccatgact
gcagcagtatag

DBGET integrated database retrieval system