KEGG   Rattus norvegicus (rat): 301468
Entry
301468            CDS       T01003                                 

Gene name
Crygb
Definition
(RefSeq) gamma-crystallin B
  KO
K23483  gamma-crystallin
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99992 Structural proteins
    301468 (Crygb)
SSDB
Motif
Pfam: Crystall IL4_i_Ig
Other DBs
NCBI-GeneID: 301468
NCBI-ProteinID: NP_001103345
RGD: 1584991
Ensembl: ENSRNOG00000032926
UniProt: P10066
Position
9
AA seq 175 aa
MGKITFFEDRGFQGRCYECSSDCPNLQTYFSRCNSVRVDSGCWMLYERPNYQGHQYFLRR
GDYPDYQQWMGFSDSIRSCRLIPQHSGTYRMRIYERDDFRGQMSEITDDCLSLQDRFHLS
EIHSLNVMEGCWVLYEMPSYRGRQYLLRPGEYRRYLDWGAANAKVGSFRRVMDFY
NT seq 528 nt   +upstreamnt  +downstreamnt
atgggaaagatcaccttcttcgaggaccgaggcttccagggccgctgctatgagtgcagc
agcgactgccccaacctgcagacctacttcagccgctgcaactccgtccgcgtggacagt
ggctgctggatgctctatgagcgacccaactaccagggccaccagtacttcctgcgacgc
ggggactaccctgactaccagcagtggatgggtttcagcgactccattcgctcctgccgc
ctcatcccccaacactcgggcacttacagaatgaggatctacgaaagagatgacttcaga
ggacaaatgtcagagatcacagacgactgtctctctcttcaggatcgcttccacctcagc
gagattcactccctcaatgtaatggagggctgctgggtcctctatgagatgcctagctac
agagggcgccagtacctgctgaggccgggagagtacaggagatatcttgactggggggct
gcaaacgccaaagttggctcttttagaagagtcatggatttttactga

DBGET integrated database retrieval system