KEGG   Rattus norvegicus (rat): 301517Help
Entry
301517            CDS       T01003                                 

Gene name
Cyp27a1, Cyp27, P450C27
Definition
(RefSeq) cytochrome P450, family 27, subfamily a, polypeptide 1
  KO
K00488  cholestanetriol 26-monooxygenase [EC:1.14.15.15]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00120  Primary bile acid biosynthesis
rno01100  Metabolic pathways
rno03320  PPAR signaling pathway
rno04979  Cholesterol metabolism
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00120 Primary bile acid biosynthesis
    301517 (Cyp27a1)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    301517 (Cyp27a1)
  09154 Digestive system
   04979 Cholesterol metabolism
    301517 (Cyp27a1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:rno00199]
    301517 (Cyp27a1)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.15  With reduced iron-sulfur protein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.15.15  cholestanetriol 26-monooxygenase
     301517 (Cyp27a1)
Cytochrome P450 [BR:rno00199]
 Cytochrome P450, animal type
  CYP27 family
   301517 (Cyp27a1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-GeneID: 301517
NCBI-ProteinID: NP_849178
RGD: 727915
Ensembl: ENSRNOG00000017188
UniProt: P17178
Position
9q33
AA seq 533 aa AA seqDB search
MAVLSRMRLRWALLDTRVMGHGLCPQGARAKAAIPAALRDHESTEGPGTGQDRPRLRSLA
ELPGPGTLRFLFQLFLRGYVLHLHELQALNKAKYGPMWTTTFGTRTNVNLASAPLLEQVM
RQEGKYPIRDSMEQWKEHRDHKGLSYGIFITQGQQWYHLRHSLNQRMLKPAEAALYTDAL
NEVISDFIARLDQVRTESASGDQVPDVAHLLYHLALEAICYILFEKRVGCLEPSIPEDTA
TFIRSVGLMFKNSVYVTFLPKWSRPLLPFWKRYMNNWDNIFSFGEKMIHQKVQEIEAQLQ
AAGPDGVQVSGYLHFLLTKELLSPQETVGTFPELILAGVDTTSNTLTWALYHLSKNPEIQ
EALHKEVTGVVPFGKVPQNKDFAHMPLLKAVIKETLRLYPVVPTNSRIITEKETEINGFL
FPKNTQFVLCHYVVSRDPSVFPEPESFQPHRWLRKREDDNSGIQHPFGSVPFGYGVRSCL
GRRIAELEMQLLLSRLIQKYEVVLSPGMGEVKSVSRIVLVPSKKVSLRFLQRQ
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atggctgtgttgagccgcatgagactgagatgggcgcttctggacactcgtgtgatgggc
catggcctctgcccacaaggggccagagccaaggccgcgatccctgcagccctccgggat
cacgagagcacggagggtccaggaacaggtcaagaccgaccgcgcctgcggagtctggcg
gagcttccgggacccggaacgctacgctttttattccagctatttctacgaggctatgtg
ctgcacttgcacgagctccaggcgctgaacaaggccaagtacggcccaatgtggacaacc
acctttgggactcgcaccaatgtgaatctggctagcgccccgctcttggagcaagtgatg
agacaggagggcaagtaccccataagagacagcatggagcagtggaaggagcaccgagac
cacaaaggcctctcctatgggatcttcatcacacaaggacagcagtggtaccatctgcgt
catagtttgaatcagcggatgctgaagcctgctgaggcagccctctacacagatgcctta
aacgaggtcatcagtgactttattgcccggctggaccaggtgcggacagagagtgcatca
ggggatcaggtgccagatgtggcacatcttctctaccaccttgccttggaagccatctgc
tatatcctgtttgagaaaagggttggctgcctggagccctccatccctgaggacaccgcc
accttcatcagatctgttggactcatgttcaagaactcagtctatgtcactttccttccc
aagtggtctcggcctctgctgcccttttggaagcgatacatgaataactgggataacatt
ttctccttcggggagaagatgattcatcaaaaagtccaggagatagaagcccagctacag
gcggctgggccagatggggtccaggtatctggctacctgcacttcctgctgactaaggaa
ttgctcagtcctcaagagactgtcggcacctttcctgagctgatcttggctggggtagac
acgacatccaatacactgacctgggccctgtatcacctttcaaagaacccagagatccag
gaagccttgcacaaggaagtgactggtgtggtacccttcgggaaggtgccccagaacaag
gactttgcccacatgcccctgctaaaagctgtgattaaggagaccctgcgcctctaccct
gtggttcccacaaactcccggatcatcacagaaaaggaaactgaaattaatggcttcctc
ttccctaagaatacacagtttgtgttatgccactacgtggtgtcccgagatcccagtgtc
tttcctgagcccgagagcttccagcctcaccgatggctgaggaagagagaggacgataac
tccgggatccaacacccatttggctctgtgccctttggctatggggttcggtcctgcctg
ggtcgcaggattgcagaactggagatgcaactcctgctgtcaaggctgatacaaaagtat
gaggtggtcctgtctcccgggatgggagaagtgaagtctgtgtcccgcatcgtcctggtt
cccagcaagaaggtgagcctacgctttctgcagagacagtag

DBGET integrated database retrieval system