KEGG   Rattus norvegicus (rat): 301529Help
Entry
301529            CDS       T01003                                 

Gene name
Dnpep
Definition
(RefSeq) aspartyl aminopeptidase
  KO
K01267  aspartyl aminopeptidase [EC:3.4.11.21]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    301529 (Dnpep)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    301529 (Dnpep)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.21  aspartyl aminopeptidase
     301529 (Dnpep)
Peptidases and inhibitors [BR:rno01002]
 Metallo peptidases
  Family M18
   301529 (Dnpep)
Membrane trafficking [BR:rno04131]
 Autophagy
  Cytoplasm to vacuolar targeting (CVT) pathway
   Selective cargos
    301529 (Dnpep)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M18 Peptidase_M42
Motif
Other DBs
NCBI-GeneID: 301529
NCBI-ProteinID: NP_001020050
RGD: 1583848
Ensembl: ENSRNOG00000019772
UniProt: Q4V8H5
Position
9q33
AA seq 475 aa AA seqDB search
MQVAMNGRARKEAIQATARELIKFVNRSPSPFHVVAECRSRLLQAGFRELKETEGWDILP
ENKYFLTRNSSTIIAFAVGGQYVPGNGFSLIGAHTDSPCLRVKRKSRRSQVGYHQVGVET
YGGGIWSTWFDRDLTLAGRVIIKCPTSGRLEQRFVHIERPILRIPHLAIHLQRNVNENFG
PNTEMHLVPILATAVQEELEKGTPEPGPLSATDERHHSVLMSLLCTHLGLSPDNIMEMEL
CLADTQPATLGGAYEEFIFAPRLDNLHSCFCALQALIDSCASPASLAREPHVRMVTLYDN
EEVGSESAQGAQSLLTELILRRISASPQRLTAFEEAIPKSFMISADMAHAVHPNYSDKHE
ENHRPLFHKGPVIKVNSKQRYASNAVSESLIREVAGQVGVPLQDLMVRNDSPCGTTIGPI
LASRLGLRVLDLGSPQLAMHSIRETACTTGVLQTLTLFKGFFELFPSVSRNLLVD
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtggccatgaacggcagagctaggaaagaggctatccaggccacagccagggag
ctcatcaagttcgtgaaccggagcccctctcctttccatgtcgtggccgagtgtcgcagc
cgcctactccaggctggcttccgtgaactcaaggaaacagagggctgggatatcttacca
gaaaacaagtacttcttaaccaggaactcctccaccatcattgcttttgctgtggggggc
cagtatgttcctggcaatggcttcagcctcattggggcccacacggacagtccctgcctc
cgggtgaaacgcaaatctcgccgaagccaggtgggctaccaccaggtgggcgtagagacc
tatggtggtgggatctggagcacgtggtttgaccgggacctgaccttggctggacgagtc
attatcaagtgccctacgtcaggcagactggagcagaggtttgtgcatatagagcggccc
atcctgcgcatcccgcatctggccatccatctgcagcgaaatgtcaatgagaactttggg
cccaacacagagatgcacctagtccctattcttgccacagcagttcaggaagagctggag
aaagggactcctgaaccagggcctctcagtgctactgatgagcggcaccactcagtcctc
atgtccctgctctgtacccatctgggactgagtcctgacaacatcatggagatggagctc
tgcctggcagacacccagcctgcaaccctgggtggagcttatgaagaattcatctttgct
cctcggctggacaatctgcatagctgcttctgtgctctgcaggcactgattgattcctgt
gcatcccctgcctccctggccagggagccacatgtgcgcatggtcacgctctacgacaat
gaagaggtggggtcagagagtgcacaaggagcacagtctctgctgacagagctgatacta
cggcgcatctcagcctcacctcagcgtctgactgccttcgaggaagccatacctaagtcc
ttcatgatcagtgcagacatggcccatgctgtgcacccaaactactcggacaagcatgaa
gaaaaccatcggcccttgttccataagggtcctgtgatcaaggtgaacagcaagcagcgc
tacgcctctaatgcggtgtctgagtccctgattcgagaggtggccggccaagttggagtc
cctctgcaggacctcatggtcaggaatgactctccatgtggtaccaccattggacctatc
ttggcttctcgactggggcttcgggtgctggacttaggcagcccccaactggccatgcac
tctatccgggagacagcctgtaccactggagttctccagaccctcacccttttcaagggc
ttctttgagctgttcccttctgtaagccgtaacctcttggtggactga

DBGET integrated database retrieval system