KEGG   Rattus norvegicus (rat): 301543
Entry
301543            CDS       T01003                                 

Gene name
Sgpp2
Definition
(RefSeq) sphingosine-1-phosphate phosphatase 2
  KO
K04717  sphingosine-1-phosphate phosphotase 2 [EC:3.1.3.-]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00600  Sphingolipid metabolism
rno01100  Metabolic pathways
rno04071  Sphingolipid signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    301543 (Sgpp2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    301543 (Sgpp2)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.-  
     301543 (Sgpp2)
SSDB
Motif
Pfam: PAP2 PAP2_3 DUF212
Other DBs
NCBI-GeneID: 301543
NCBI-ProteinID: NP_001178740
RGD: 1565739
Ensembl: ENSRNOG00000037695
UniProt: F1LZ44
Position
9
AA seq 354 aa
MAELLRSLRDSELVARFQRRCGLFPGQEASGEKHVVKNYFYYYLFRFSAALGQEVFYITF
LPFTHWNIDPYLSRRLVVIWVLVMYIGQVAKDILKWPRPSSPPVVKLEKRVIAEYGMPST
HAMAATAISFTLLISTMDRYQYPFILGLIMAVVFSTLVSLSRLYTGMHTVLDVLGGVLIT
AVLIALTYPAWTLIDSLDSASPLFPVCVIVVPFLLCYNYPVSDYYSPTRADTTTVVAAGA
GVTVGFWINHFFQLVSKPTPSLPVIQNIPPITTDMLVLGLTKFMVGIMLILLVRQLVQNL
SLQVLFSWFKVVTKNKEARRRLEIEVPYKFVTYTSVGICATTFVPMLHRFLGLL
NT seq 1065 nt   +upstreamnt  +downstreamnt
atggctgagctgctgcggagcctgagggattcagagctcgtggcacgcttccagcggcgc
tgcgggctctttccagggcaggaggcttctggtgagaagcatgttgtgaagaattatttc
tactattacctgttccggttttcagctgctttgggtcaggaggtgttctacatcacattt
ctcccattcacccactggaatatcgacccttatttgtccagaagattggtcgtgatatgg
gttttggtgatgtacattggccaggtggccaaggacatcctgaagtggccccggccctcc
tctcctcccgttgtgaagcttgaaaagagagtgattgcagaatatggaatgccatccacc
catgccatggccgccaccgccatttctttcaccctcctcatctccaccatggacaggtac
cagtaccctttcattttaggcctgatcatggctgtcgtgttctctacactggtgagtctc
agcagactctacacggggatgcacacagtcctggatgtcctgggtggcgttctaatcacg
gcggtcctcatcgccctgacctaccctgcctggaccctcatcgactccctggactccgcc
agccctctcttccctgtgtgtgtcatagttgtgccgttcctcttgtgctacaattaccct
gtgtccgactactacagcccgaccagagcggacaccaccaccgtcgtggctgccggcgct
ggagtgaccgtaggattctggatcaaccacttcttccagctcgtgtccaagcccaccccg
tccctccctgtgattcagaacatcccccccattaccactgacatgctggttttaggcctg
accaaatttatggtggggatcatgttgatcctcttggttcgccaactggtgcaaaacctc
tctctgcaagtgttattctcatggttcaaggtggttactaagaacaaggaggccaggcga
agactagagattgaagtcccttacaagtttgtcacctacacatctgttggcatctgtgcc
acaacctttgtgccaatgttgcacaggtttttgggattgctctga

KEGG   Rattus norvegicus (rat): 81536
Entry
81536             CDS       T01003                                 

Gene name
Sgpp1
Definition
(RefSeq) sphingosine-1-phosphate phosphatase 1
  KO
K04716  sphingosine-1-phosphate phosphatase 1 [EC:3.1.3.-]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00600  Sphingolipid metabolism
rno01100  Metabolic pathways
rno04071  Sphingolipid signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    81536 (Sgpp1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    81536 (Sgpp1)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.-  
     81536 (Sgpp1)
SSDB
Motif
Pfam: PAP2 PAP2_3
Other DBs
NCBI-GeneID: 81536
NCBI-ProteinID: NP_110501
RGD: 727829
Position
6
AA seq 429 aa
MSLGQRLALLAIRLQEPQRVASFQRLCGGRSARQPKAGEDAETEVRGAPGDPRRRPRQSG
ADGSPAKPDCCGAPNGVRNGLAAEPGPTGPRRAGSLRRNSLTGEEGELAKVSNLPLYYLF
CFGTELGNELFYIIFFPFWIWNLDPFVGRRLVIIWVLVMYLGQCTKDIIRWPRPASPPVI
KLEIFYNSEYSMPSTHAMSGTAIPIAMILLTYGRWQYPLIYGLILIPCWSSLVCLSRIYM
GMHSILDVIAGFLYTILILIIFYPLVDLIDNFNQTYKYAPLIIIGLHLILGIFSFTLDTW
STSRGDTAEILGSGAGIACGSHAAYNLGISLDPSLHTLPLAIPPLTVTLFGKAILRVVIG
MLLVLFVRDIMKKVTIPLACKLFGIPCHDLRQARQHMEVELPYRYITYGTVGFSITFLIP
YIFSFIGIS
NT seq 1290 nt   +upstreamnt  +downstreamnt
atgtccctggggcagcgactggctctgctagccatccgtctgcaggagccgcagcgggtg
gcgagcttccagcgtctgtgtggggggaggtccgctcggcagccgaaggcgggcgaggat
gcagagaccgaggttcgcggagccccgggagacccccggcgacggccacggcagtcgggc
gctgacggcagcccggccaagcccgactgctgcggtgcaccgaacggcgtgcgaaacggg
ctggcggccgagccgggcccgaccgggccccgccgcgcgggctcgctgcggcgcaactcg
ttgacgggcgaggagggcgagctggccaaagtgagcaacttgccgctctactacctgttc
tgcttcggcaccgaactgggcaacgagctcttctacatcatcttcttccccttctggatc
tggaatctggacccctttgtgggccggaggctggtgatcatctgggtgctggtcatgtac
ctgggccagtgcaccaaggacatcatccgttggccgcggccggcctcgccgccggtcatc
aagctggagatcttctacaattcggaatacagcatgccttccacgcatgccatgtccggc
accgccatccccatcgccatgatcctgctcacctatggccgctggcagtatcctcttata
tatgggctgattctcattccctgttggagttctctagtttgcctaagtagaatctacatg
ggaatgcattccatcctggacgtcattgctggattcttgtataccattttaatccttatt
atcttctacccattggtggacctgattgacaacttcaaccaaacttacaaatatgccccg
ctcatcatcatcgggcttcacttgattttgggcattttttctttcacccttgacacctgg
agcacatcccgaggagacacggctgagattctggggagtggtgctgggattgcctgtggc
tcgcacgccgcttataacctgggtatatccttagacccttctctgcacacgttaccctta
gctatcccccctcttacggtaactctgtttggaaaagccatattacgggtcgtcataggg
atgttgcttgtactgttcgtaagagatatcatgaagaaggtcaccattcctctagcctgc
aaactcttcggtattccgtgtcatgaccttcgccaagcaaggcagcacatggaagtggag
ctgccctaccggtatattacctacgggacggttggtttctccatcacgtttttgatcccc
tacatattttcctttatcggtatctcttga

DBGET integrated database retrieval system