KEGG   Rattus norvegicus (rat): 301544Help
Entry
301544            CDS       T01003                                 

Gene name
Farsb, Farslb
Definition
(RefSeq) phenylalanyl-tRNA synthetase, beta subunit
  KO
K01890  phenylalanyl-tRNA synthetase beta chain [EC:6.1.1.20]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    301544 (Farsb)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:rno01007]
    301544 (Farsb)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:rno03016]
    301544 (Farsb)
Enzymes [BR:rno01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.20  phenylalanine---tRNA ligase
     301544 (Farsb)
Amino acid related enzymes [BR:rno01007]
 Aminoacyl-tRNA synthetase
  Class II (U)
   301544 (Farsb)
Transfer RNA biogenesis [BR:rno03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    301544 (Farsb)
 Prokaryotic type
    301544 (Farsb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA_synthFbeta PhetRS_B1 B3_4 B5
Motif
Other DBs
NCBI-GeneID: 301544
NCBI-ProteinID: NP_001004252
RGD: 1303210
Ensembl: ENSRNOG00000014119
UniProt: Q68FT7
Position
9q33
AA seq 589 aa AA seqDB search
MPTVSVKRDLLFQVLGRTYTDEEFDELCFEFGLELDEITSEKQIISKEQGNVKAQGASDV
VLYKIDVPANRYDLLCLEGLARGLQVFKERIKAPVYKRVMPKGEIQKLIITEETAKVRPF
AVAAVLRNIKFTKDRYDSFIELQEKLHQNICRKRALVAIGTHDLDTLSGPFTYTAKRPSD
IKFKPLNKTKEYTACELMNIYKTDNHLKHYLHIIESKPLYPVIYDSNGVVLSMPPIINGN
HSKITVNTRNIFIECTGTDLTKAKIVLDIIVTMFSEYCENQFTVEAAEVVSPSGKSSTLP
ELPYRKEMVRADLINKKVGIKETPANLAKLLTRMCLKSEVIGDGNQIEVEIPPTRADVIH
ACDIVEDAAIAYGYNNIQMTLPKTYTIANQFPLNKLTELLRLDMAAAGFTEALTFALCSQ
EDIADKLGLNISATKAVHIGNPKTAEFQVARTTLLPGLLKTIAANRKMPLPLKLFEISDI
VVQDPSKDVGAKNYRHLCAVYYNKNPGFEIIHGLLDRIMQLLDVPPGEESGGYVIKASAG
SAFFPGRCAEIFVGGQSIGKLGVLHPDVITKFELTMPCSSLEINIEPFL
NT seq 1770 nt NT seq  +upstreamnt  +downstreamnt
atgccgactgtcagcgtgaagcgagacctgctcttccaagtcctgggccggacctacact
gatgaagaatttgatgaactgtgttttgaatttggtctggaacttgatgaaattacttct
gagaagcaaatcataagcaaggaacaaggtaatgtgaaagcacagggggcctcagatgtc
gtgctctacaagattgatgtccctgccaacagatacgatctcctgtgtctggaaggattg
gctcggggactccaagtcttcaaagaaaggataaaagctccagtatataaacgagtaatg
cctaagggagaaatccaaaaactgattatcacagaagagacagctaaagtacgccctttt
gctgtagcagcagttctccggaatatcaagttcactaaagaccgatatgacagctttatt
gaacttcaagagaaactacaccagaatatttgcaggaaaagagcattggttgctattggc
actcacgacttggacactttatcaggcccatttacttacactgcaaaacgcccttcagat
atcaaattcaagcctctgaataagaccaaggagtatacagcctgtgaattaatgaacata
tacaagactgacaatcaccttaaacactatttacatatcattgaaagtaagcccctgtat
ccagttatctatgacagcaatggagtggtcctctcgatgcctccgattataaatgggaat
cattcaaaaataacagtaaatactaggaatatatttattgaatgcacagggactgactta
actaaggcaaaaatcgtgcttgacattattgtcaccatgttcagtgaatactgtgaaaat
cagtttacagtagaagcagctgaagtagtttctcctagtggaaaatcgagtacccttcca
gagctgccctacagaaaggagatggtgagagctgatctgattaataagaaagttggaatc
aaagagactcctgcaaatcttgccaaactcctgaccaggatgtgtctgaagtcagaagtc
ataggtgatggcaatcagattgaggttgaaatccctccgaccagagccgatgtcatccat
gcgtgtgacattgtggaggacgcagctattgcttatggttataacaacattcagatgact
ctcccgaaaacatacaccatagctaatcaatttcctctcaacaaactcacagagctcctc
agacttgacatggctgccgctggcttcaccgaagcactgacttttgctctgtgttcccaa
gaagatattgctgataagcttggcttgaacatctctgcaacaaaggcagtccacataggt
aaccccaaaaccgctgagttccaggtggcgcgcactacccttcttcctggccttctgaag
accattgcagcaaaccggaagatgccccttcctctcaagctgttcgagatctctgacatc
gtagtccaggatcctagcaaagatgtaggcgcaaaaaactacaggcatctctgtgctgtt
tattacaacaagaatcctgggtttgagatcatccatggactgctggacagaattatgcag
ctgctcgatgtgcctcccggtgaggaaagtgggggctacgtgatcaaagcctccgcaggt
tctgcattcttccctggacggtgtgccgagatctttgtcgggggtcaaagtatcgggaag
ctaggcgtccttcatcccgatgttattaccaaatttgagctgaccatgccctgttcctct
ctggaaatcaatattgagccctttctgtga

DBGET integrated database retrieval system